DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and SPAPB1E7.08c

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_594134.1 Gene:SPAPB1E7.08c PomBaseID:SPAPB1E7.08c Length:554 Species:Schizosaccharomyces pombe

Alignment Length:450 Identity:106/450 (24%)
Similarity:185/450 (41%) Gaps:92/450 (20%)


  Fly   172 GLVVGTALSGYLADRYGRKHIFLFCIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFI 236
            ||:||..:....||..||:..|....:|..:..|....|.::.|...|..|.:.|..|..|:...
pombe   130 GLLVGAMVWSLSADTIGRRWAFNLTFLFTGVFAVIAGASPNFASICVFDALWSFGVGGNLPVDSA 194

  Fly   237 IGVEMVGPRKREMSSIVLNYFYAVGEALLGL-------SVFLPD------------WRQLQLALS 282
            |.:|.: |...:....|:::::|:|:.:..|       :...||            ||.....:.
pombe   195 IFLEAL-PSSHQWLLTVMSFWWAIGQVIANLVSWGLISNFSCPDDESVCHRADNKGWRYFLFTMG 258

  Fly   283 VPPLICVAYFWLVP--ESVRWLLARNRREQAGVIIRRAAKVNRR--DISVELMASF---KQQELD 340
            ...|:..|..:||.  ||.::.||:....:|...|.:.|::|.:  .::||.:.:.   :|:|.|
pombe   259 GMTLLMFAARFLVSVYESPKFYLAKGDDYKAVETIHKIARINGKTCTLTVEELYAIDRQEQEESD 323

  Fly   341 AETGQEDDVEG------GLHVKKDDKI-------WLAVKEVARSHILMGRYAILLLIWAV----- 387
            .:..:..|.:.      .|.|:|..|.       ....:::|.|.||      ::|.|||     
pombe   324 LDDSKSSDAKSVTQGTTNLIVEKLRKYNFEHIRQCFGSRKLAISSIL------VILSWAVIGLAF 382

  Fly   388 ---NAIVYYGLSLNATS---LSGNK-YLNFALVCLVEIPGYSLAWLFLR-RFGRRVALSGSLLLC 444
               ||.:.|.|.....:   ||..| |.|..:|..:.:||..:|.:.:. |.||:..|..||:|.
pombe   383 PLYNAFLPYYLETRGNANEPLSVAKTYRNSLIVSAIGVPGSLIAGVLVEFRIGRKGTLCLSLILT 447

  Fly   445 SITCVASGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSF------AVIYTFT 503
            .:...||   |.|:..        .:...|:|                |.||      .|:|.:|
pombe   448 GVFLFAS---TTAKTS--------NAYLGWNC----------------TFSFFSDIMYGVLYAYT 485

  Fly   504 AEMMPTVIRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLP 563
            .|:.|:.:|...||:.::..|...:.:|.:.:.|:.....|:.:.|.|.:.||:|.:..|
pombe   486 PEVFPSKVRGTAVGLAASANRILGIFSPVIAMRANLTTSAPIFVSGALFIFAGILVVFFP 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 106/450 (24%)
MFS 158..533 CDD:119392 98/419 (23%)
SPAPB1E7.08cNP_594134.1 2A0109 68..552 CDD:129965 106/450 (24%)
MFS 122..545 CDD:119392 105/449 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I1757
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.