DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and Y82E9BR.16

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001022960.1 Gene:Y82E9BR.16 WormBaseID:WBGene00022348 Length:575 Species:Caenorhabditis elegans

Alignment Length:632 Identity:174/633 (27%)
Similarity:297/633 (47%) Gaps:149/633 (24%)


  Fly    13 LDFDDIL-VEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVP------------ 64
            :.|||.| ..:||.|::|:..:.|:|||.:..:.::||:.|.:....|||.:|            
 Worm     1 MKFDDFLFTYLGEMGKYQKIQFFLVCLPTIVVSMHALSWTFASVDTPYRCRLPSDLPEKEPYYTT 65

  Fly    65 -----ECDKLVDA-----EYGANWVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWP 119
                 :|....||     |||.       ||          .||.                    
 Worm    66 LLNFTKCTNDADANVPISEYGK-------PG----------VTCH-------------------- 93

  Fly   120 LDQCFAENFTTETERCNQFVYGSS--ERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGY 182
            .|:|    ...:.|.|::.::..|  |.|.||:|.:.| :..|..|.:...::.|.:.|:...|.
 Worm    94 YDRC----TLPDNETCHEHIFDHSKVEYTAVQRWEITC-DRSWIKATIQAAYYVGQMAGSTTFGM 153

  Fly   183 LADRYGRKHIFLFCIVFMALTG--VAQALSWDYISFLFFALLNAVGTS----GVYPLAFIIGVEM 241
            |.||.|||.:|...||......  :|.|..|     ..:||..| ||.    |::.:|.:||:|:
 Worm   154 LGDRIGRKKVFFLAIVIQITCAYLIAIAPYW-----WLYALARA-GTGFSHPGIFVIAVVIGMEL 212

  Fly   242 VGPRKREMSSIVLNYFYAVGEALLGL-SVFLPDWRQLQLALSVPPLICVAYF------------- 292
            |||:.|:::|::...|:|:|:..||: :::..:::.|.:.::.|.|:.::|.             
 Worm   213 VGPKYRKLASVITGLFFALGQIFLGIEAIYFTNYQILHVVIASPALLFLSYCQKSAKNRKKIDFA 277

  Fly   293 ----------------WLVPESVRWLLARNRREQAGVIIRRAAKVNRRDISVELMASFKQQELDA 341
                            ||||||.|||:::.|.::|..::::||.||    ...|..::.:|..|:
 Worm   278 NFLADFLLKNRFFFSRWLVPESARWLVSQKRYKEADEVLQKAASVN----GTVLPENWWEQLDDS 338

  Fly   342 ETGQEDDVEG----GLHVKKDDKIWLAVKEVARSHILMGRYAILLLIWAVNAIVYYGLSLNATSL 402
            .||      |    |...||     |...::.|:..|..|..::..:|.|.::||||:::.|..|
 Worm   339 TTG------GGGAPGAPTKK-----LTGADLFRTPELRKRTLVVFFLWPVISMVYYGMAMKANVL 392

  Fly   403 SGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSITCVASGFVTLAQGDWIPCQTG 467
            .|:.|:||.....||||...:.:|.:.|.|||:.|:|.|.:.. .|:   .|....||.:..   
 Worm   393 GGDIYVNFIFAAFVEIPALFIVYLLIDRIGRRLILAGGLFIAG-ACL---LVNWLMGDNVQL--- 450

  Fly   468 VESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRSGGVGVMSTFARFGAMLAPF 532
                       |:.:|.....|..||..:|.|||::.|:.|||||:..:|..||.||.||:.|.:
 Worm   451 -----------WMAITQMAFTKGSITGVYAAIYTYSPELFPTVIRNTAMGFCSTIARVGAIAASY 504

  Fly   533 VPL-LASYYDPLPLLL-FGTLSLVAGLLSLL-LPETFNRKLPDTVEE 576
            :.: :|..:..:.::: ||.::::|.:::|| ||||..:.||:::||
 Worm   505 ISMWIAEQFGKVFMIIPFGCMAVLAAVMTLLFLPETMGKPLPESIEE 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 168/617 (27%)
MFS 158..533 CDD:119392 120/415 (29%)
Y82E9BR.16NP_001022960.1 2A0119 12..547 CDD:273328 168/616 (27%)
MFS 130..536 CDD:119392 126/445 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.