DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and oct-1

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_492617.4 Gene:oct-1 WormBaseID:WBGene00003842 Length:585 Species:Caenorhabditis elegans

Alignment Length:599 Identity:174/600 (29%)
Similarity:283/600 (47%) Gaps:108/600 (18%)


  Fly    14 DFDDILVEIGEFGRFQRRNYLLICLPV-LFAAANSLSYVFTAGSPTYRCYVPECDK--------- 68
            |||.:|.::|.:|.:|...:.:||||. |.:|.::.:..|..|:|.:.|::||..:         
 Worm    25 DFDFVLEQVGNYGTYQIVFFFIICLPTSLPSAFSAFNIPFVVGNPPHTCHIPEGKEYLRPLTNDT 89

  Fly    69 --LVDAEYGANWVSI------AVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFA 125
              |...:|....:::      |...::|.|....|  |:    ||            |..|    
 Worm    90 QILSCKQYNETQINVFRAFTSAPVDTYSDRISLVP--CQ----NG------------WDYD---- 132

  Fly   126 ENFTTETERCNQFVYGSSERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRK 190
             |.|          |..|   :|.::.|.|.:..| :....|..:.|..:|..|.||:||::||:
 Worm   133 -NST----------YLDS---LVTEFNLVCDQQAW-IEISTTSFYVGSFIGNCLFGYVADKFGRR 182

  Fly   191 HIFLFCIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLN 255
            ..|...:..:.:.|.|.:.:.|..||:.......:....::.:.|||.:|.:|...|..|.::.:
 Worm   183 RSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRIFSGLMTS 247

  Fly   256 YFYAVGEALLG-LSVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAA 319
            .|:....|||| :::|:..||||....:.|....:.|::.:|||.||.::..:...|...:::.|
 Worm   248 LFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIA 312

  Fly   320 KVN-RRDISV-ELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSH---------I 373
            |:| :.::.| ||:.|.|..:..||.                      ||..|||         .
 Worm   313 KMNGKSNVDVDELVDSMKNHQNAAEE----------------------KETKRSHNVTDLFKTPN 355

  Fly   374 LMGRYAILLLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALS 438
            |..:..|:..||.:|||:|.||:||.::|..:.|.:|.:...||:|||.:.|..|:..|||..|:
 Worm   356 LRRKTLIVTYIWVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVELPGYFVVWPLLQCAGRRWTLA 420

  Fly   439 GSLLLCSITCVASGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFT 503
            .::::|.|.||::.|:.    |..|               |||.:...:||.|:.|.|||||.|.
 Worm   421 ATMIVCGIGCVSAMFMP----DGYP---------------WLVASASFIGKFGVGSGFAVIYIFA 466

  Fly   504 AEMMPTVIRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNR 568
            .|:.|||:|:.|:|:.|..|..|.:|||.:..|......||||:.|.::|.||:|:..||||...
 Worm   467 GELYPTVVRAIGMGMSSMVAGSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILTFFLPETLGA 531

  Fly   569 KLPDTVEEAIALGK 582
            .||.|:|:|...||
 Worm   532 PLPMTIEDAENFGK 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 165/580 (28%)
MFS 158..533 CDD:119392 116/387 (30%)
oct-1NP_492617.4 2A0119 34..536 CDD:273328 165/580 (28%)
MFS 134..526 CDD:119392 133/447 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.