DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and SLC22A12

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_006718493.1 Gene:SLC22A12 HGNCID:17989 Length:578 Species:Homo sapiens

Alignment Length:605 Identity:166/606 (27%)
Similarity:273/606 (45%) Gaps:96/606 (16%)


  Fly    15 FDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECD------KLVDAE 73
            |.::|..:|..||||....:.:.:.:::....|:...|:|..|::||:.|..|      .::.:.
Human     3 FSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAQASILGSL 67

  Fly    74 YGANWVSIAVPGSWSKRGHFTPSTCERFVANGDHL---ESSSDPWSAWPLDQCFAENFTTETERC 135
            .....::|::|...::|    |..|.||......|   .:::..||            ..:||.|
Human    68 SPEALLAISIPPGPNQR----PHQCRRFRQPQWQLLDPNATATSWS------------EADTEPC 116

  Fly   136 -NQFVYGSS--ERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFLFCI 197
             :.:||..|  ..|||.:|.|.|..:..| ....:|:.||::||.|..|..:||:||:.:..:..
Human   117 VDGWVYDRSIFTSTIVAKWNLVCDSHALK-PMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSY 180

  Fly   198 VFMALTGVAQALSWDYISFLFFALLNAVGTSGVY-------------------------PLAFII 237
            :.||:.|.|.|.:..:..:..|..|.|...:||.                         ||..:.
Human   181 LQMAVMGTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLRRSLTWRHAGGLHAGSRAEPLGLLA 245

  Fly   238 GVEMVGPRKREMSSIVLNYFYAVGEALLGLSVF-LPDWRQLQLALSVPPLICVAYFWLVPESVRW 301
            .:|....|.|.:...:.:..::.|..|.....: :.||..|||.:|||..:|..|.|.:.||.||
Human   246 VMEWTAARARPLVMTLNSLGFSFGHGLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLAESARW 310

  Fly   302 LLARNRREQAGVIIRRAAKVNRR-----DISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKI 361
            ||...|.:.....:.|.|.:|.:     .::.|::.|..::||  ..||.....|.|        
Human   311 LLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREEL--SMGQPPASLGTL-------- 365

  Fly   362 WLAVKEVARSHILMGRYAILLLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWL 426
                   .|...|..|..|..|.|......::||:|:..:|..|.:|....:.:|:||....|.|
Human   366 -------LRMPGLRFRTCISTLCWFAFGFTFFGLALDLQALGSNIFLLQMFIGVVDIPAKMGALL 423

  Fly   427 FLRRFGRRVALSGSLLLCSITCVASGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLG 491
            .|...|||..|:.||||..:..:|:   ||     :|.:.|.           |...|.::|..|
Human   424 LLSHLGRRPTLAASLLLAGLCILAN---TL-----VPHEMGA-----------LRSALAVLGLGG 469

  Fly   492 ITSSFAVIYTFTAEMMPTVIRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAG 556
            :.::|..|..:::|:.|||:|...||:....||.||:|.|.|.||..:...||||::||:.:::|
Human   470 VGAAFTCITIYSSELFPTVLRMTAVGLGQMAARGGAILGPLVRLLGVHGPWLPLLVYGTVPVLSG 534

  Fly   557 LLSLLLPETFNRKLPDTVEE 576
            |.:||||||.:..||||:::
Human   535 LAALLLPETQSLPLPDTIQD 554

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 163/593 (27%)
MFS 158..533 CDD:119392 108/406 (27%)
SLC22A12XP_006718493.1 2A0119 11..551 CDD:273328 163/593 (27%)
MFS 122..541 CDD:119392 130/456 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C100092774
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.