DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and Slc22a7

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_659105.2 Gene:Slc22a7 MGIID:1859559 Length:540 Species:Mus musculus

Alignment Length:592 Identity:172/593 (29%)
Similarity:274/593 (46%) Gaps:84/593 (14%)


  Fly    13 LDFDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGAN 77
            :.|:::|.::|.||.||.||.:|:.||......:.|..:|.|..|.:.|.:|  |...:..:...
Mouse     1 MGFEELLHKVGGFGPFQLRNLVLLALPRFLLPMHFLLPIFMAAVPAHHCALP--DAPANLSHQDL 63

  Fly    78 WVSIAVPGSWSKRGHFTPSTCERF--------VANGDHLESSSDPWSAWPLDQCFAENFTTETER 134
            |:...:|....  |.|  |:|.||        |..|..:.:|.:| ...||           |..
Mouse    64 WLKTHLPRETD--GSF--SSCLRFAYPQALPNVTLGTEVYNSGEP-EGEPL-----------TVP 112

  Fly   135 CNQ-FVYGSSE--RTIVQQWGLQCPE-NLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFLF 195
            |:| :.|..||  .||..:|.|.|.: .|.|:  ..|..|.|:::|..:.|||:||:||:.:.|.
Mouse   113 CSQGWEYDRSEFSSTIATEWDLVCQQRGLNKV--TSTCFFIGVLLGAVVYGYLSDRFGRRRLLLV 175

  Fly   196 CIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAV 260
            ..|.....|:..|.|.:||.|:...:|.....:|...:...:.:|.:....|.::.::...|:..
Mouse   176 AYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTG 240

  Fly   261 GEALLGLSVFL-PDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAAKVNRR 324
            |..||.|..:| ..||.|.||.::|.:..:...|.||||.||||.:.|.|:|...:...||:|.|
Mouse   241 GVLLLTLVGYLIRSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNGR 305

  Fly   325 DISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVAR--SHILMGRYAIL------ 381
            .||.:   |..|:.|                   :|: :.::.|::  |::.:.|.:.|      
Mouse   306 PISED---SLSQEAL-------------------NKV-ITMERVSQRPSYLDLFRTSQLRHVSLC 347

  Fly   382 -LLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCS 445
             :::|......||||:|:|:.|....|....|...||:|.....:..:|..|||:..:|.||..:
Mouse   348 CMMMWFGVNFSYYGLTLDASGLGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLTEAGMLLATA 412

  Fly   446 ITCVASGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTV 510
            :|   .|...|...|          ..||      :..|.::||....::|...|.||:|:.|||
Mouse   413 LT---FGISLLVSSD----------TKSW------ITALVVIGKAFSEAAFTTAYLFTSELYPTV 458

  Fly   511 IRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTVE 575
            :|..|:|..:...|.||.|||.|.||...:..||.|.:|.:|.:|....||||||...:||:|::
Mouse   459 LRQTGMGFTALIGRLGASLAPLVVLLDGVWLLLPKLAYGGISFLAACTVLLLPETKKAQLPETIQ 523

  Fly   576 EAIALGK 582
            :....|:
Mouse   524 DVERKGR 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 168/572 (29%)
MFS 158..533 CDD:119392 109/385 (28%)
Slc22a7NP_659105.2 2A0119 11..521 CDD:273328 168/572 (29%)
MFS 146..511 CDD:119392 119/407 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.