DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and LOC100490266

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_002937554.2 Gene:LOC100490266 ID: Length:556 Species:Xenopus tropicalis

Alignment Length:583 Identity:168/584 (29%)
Similarity:276/584 (47%) Gaps:79/584 (14%)


  Fly    13 LDFDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGAN 77
            :.|.::|...|..||||....:|:|.|:|..|:::|...|:|..|.::|      |..|..|.:|
 Frog     1 MSFAELLERTGGMGRFQITQVVLLCFPILLMASHNLLQNFSAAIPDHKC------KANDTGYQSN 59

  Fly    78 ------WVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTTE--TER 134
                  :..::.|  ....|.  |..|..:|.....:..|:..|           |.::|  |..
 Frog    60 STDETGYERLSAP--LDANGQ--PDRCLEYVEIQWRMVGSNSTW-----------NNSSELATRP 109

  Fly   135 CN-QFVYGSSE--RTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFLFC 196
            |. .:.|...|  .||:.:|.|.|.... :.....:|:..|::||..:.|.|:|||||:.:.::.
 Frog   110 CTIGWEYSKDEFSSTIITEWDLVCGRKT-RRQLAQSIYMGGVLVGAIILGGLSDRYGRRALLIWS 173

  Fly   197 IVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAVG 261
            ...:|::||..|.|.:|:|:..|..|..:..||:......:.||.|..|.|.::..:..:.|..|
 Frog   174 YFQLAVSGVCAAFSPNYLSYCIFRFLTGMALSGIGLNTTALIVEWVPTRVRTVTGTLAGFSYTAG 238

  Fly   262 EALL-GLSVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAAKVNRR- 324
            :.|| ||:..:.|||.|||.:|:|..|...|.|..|||.|||:...:.|:|...||:.|.:|.: 
 Frog   239 QLLLAGLAYGMRDWRWLQLCVSLPFFIYFLYAWWFPESARWLVLSGKPEKAVKEIRKVANLNGKK 303

  Fly   325 ----DISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAILLLIW 385
                .|::|.:.|...:||.:.                 |...:|.::.|::.:......|.|:|
 Frog   304 EEGEKITLESLKSEMIKELASA-----------------KSSYSVIDLVRTNTIRRISCALSLVW 351

  Fly   386 AVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSITCVA 450
            ...:..||||:::....:.:.||...:...|:.|...::...:...||:.....||:|..|..:|
 Frog   352 FSTSFAYYGLAMDLQKFNVSIYLIQVIFGAVDFPAKLVSATAMIYVGRKFTQFMSLILGGIAIIA 416

  Fly   451 SGFVTLAQGDWIP--CQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRS 513
            :.||        |  .||             :..:|.:.||..:.:||:.|:.:|.|:.|||||.
 Frog   417 NIFV--------PNELQT-------------VRTSLAVFGKGCLAASFSCIFLYTTELYPTVIRQ 460

  Fly   514 GGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTVEE 576
            .|:|:.||.||.|.::||.|.:|...|..:|||::|...:::||....||||.|:.||||:||
 Frog   461 SGLGMCSTMARIGGIVAPLVKILGELYPFVPLLIYGGAPIISGLCVFFLPETVNKPLPDTIEE 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 163/569 (29%)
MFS 158..533 CDD:119392 109/383 (28%)
LOC100490266XP_002937554.2 2A0119 11..520 CDD:273328 163/569 (29%)
MFS 140..510 CDD:119392 119/408 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.