DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and slc22a7b.3

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_001337264.3 Gene:slc22a7b.3 ZFINID:ZDB-GENE-131120-103 Length:546 Species:Danio rerio

Alignment Length:596 Identity:165/597 (28%)
Similarity:278/597 (47%) Gaps:97/597 (16%)


  Fly    13 LDFDDILVEIGEFGRFQRRNYLLIC--------LPVLFAAANSLSYVFTAGSPTYRCYVPECDKL 69
            :.|:|::.||..|||||:   :::|        :|..|..:|     |.|..|::.|.:...|  
Zfish     1 MKFEDLITEINGFGRFQK---MILCISFVGRFIIPCHFLLSN-----FIAAIPSHHCDISFLD-- 55

  Fly    70 VDAEYG----ANWVSIAVP----GSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAE 126
            .|..:|    ...:.::||    ||        |.:|..|......|..:|...|..|:.:|  :
Zfish    56 ADGLFGNLTEEERLIVSVPTQEDGS--------PVSCHMFSHPQFQLLINSSSSSDLPVVEC--Q 110

  Fly   127 N---FTTETERCNQFVYGSSERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYG 188
            |   |...|     |:     .|:..||.|.| :|......|.||.|.|::.|.|..|.::||:|
Zfish   111 NGWHFDNST-----FI-----STLATQWDLVC-DNRGLNKAVATIFFVGVMFGAAFFGGMSDRFG 164

  Fly   189 RKHIFLFCIVFMALTGVAQALSWDY-ISFLFFALL---NAVGTSGVYPLAFIIGVEMVGPRKREM 249
            ||.:.|...:    :|:|.||:..: .||..||:|   :....:|:..::.::.:|.|....|.:
Zfish   165 RKPMLLVSYI----SGMAFALASVFSTSFTMFAVLRFFSGFTITGIVIVSSVLNLEWVDIEHRRL 225

  Fly   250 SSIVLNYFYAVGEALLGL-SVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGV 313
            .||:.:..:|||...|.| :.|:.|||.|.:|::.|.::|...:|.||||.|||:|....|:|..
Zfish   226 VSIIDSMAWAVGSTSLALIAYFIRDWRWLTVAVTSPLVLCTILWWWVPESARWLIANGDVEKAHY 290

  Fly   314 IIRRAAKVNRRDISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRY 378
            .:.:.|.:||:   .|:.:..|.:.|            .:.|....|......::.|:. .|.:.
Zfish   291 YLHKCAVMNRK---AEVTSRIKPEAL------------AISVSDQGKKKYTYLDLVRTP-KMRKL 339

  Fly   379 AILL-LIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLL 442
            |:|. .:|...|.:.||:|||.|....|.||...:...:|:|...:.:..|.:.|||...:|:.|
Zfish   340 AMLTGTVWFCVATMTYGISLNITGFGLNMYLTQFVYGAIEVPSKLIVYYLLEKIGRRKTEAGAQL 404

  Fly   443 LCSITCVASGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLV-GKLGITSSFAVIYTFTAEM 506
            ...|:.:.:.|:...|                    |:..|:..| ||....::|..|..:::|:
Zfish   405 FAGISLMINIFIPKDQ--------------------WIGRTVVAVLGKGFAVAAFCTIVLYSSEL 449

  Fly   507 MPTVIRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLP 571
            .|||:|..|:|..|..||.|..:||.|.||.:::......:..:::|:|.:::..||||.:|.||
Zfish   450 YPTVLRQNGMGYNSFLARLGVSVAPLVLLLDTFWGQFSQTILCSVALIASVVAWNLPETRDRCLP 514

  Fly   572 DTVEEAIALGK 582
            :|:|:....||
Zfish   515 ETIEDVEGTGK 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 157/576 (27%)
MFS 158..533 CDD:119392 108/382 (28%)
slc22a7b.3XP_001337264.3 2A0119 12..516 CDD:273328 157/575 (27%)
MFS 141..506 CDD:119392 113/405 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.