DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4630 and si:dkey-166k12.1

Sequence 1:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_001341287.1 Gene:si:dkey-166k12.1 ZFINID:ZDB-GENE-120215-78 Length:537 Species:Danio rerio

Alignment Length:571 Identity:186/572 (33%)
Similarity:294/572 (51%) Gaps:77/572 (13%)


  Fly    13 LDFDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGAN 77
            ::||.:|..||.||::|:..|:.||||.:|...:.::.|||..:|.:||                
Zfish     1 MNFDQLLATIGGFGKYQKLLYVWICLPQIFLGFHMMASVFTGATPPHRC---------------- 49

  Fly    78 WVSIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCFAENFTTETERCN---QFV 139
                  .||.|....:|      |.:|..|:..|....:.: .|.|.|.:....:.|.|   .:|
Zfish    50 ------RGSTSGMEDWT------FTSNLSHVNLSISRLAGF-ADACTAASGVNRSARTNCETGWV 101

  Fly   140 YGSS--ERTIVQQWGLQCPENLWKLAFVG-TIHFAGLVVGTALSGYLADRYGRKHIFLFCIVFMA 201
            |...  :.|.|.:|.|.|.:.  .|:.:| :|:..||:||..:.|.:||||||:...|..:....
Zfish   102 YSHEVFQSTTVTEWDLVCDKR--GLSSLGSSIYMLGLLVGAVVFGAMADRYGRRFAMLVSLALQT 164

  Fly   202 LTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAVGEALL- 265
            :.|||.|.:.::..::....:..:..|||...||::|.|....::|.::.|..:||:..|..|| 
Zfish   165 VFGVAAAFAPNFPVYVGLRFIIGMTVSGVIINAFVLGTEWTCTQRRMLAGIFTDYFFGFGYMLLA 229

  Fly   266 GLSVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAAKVNRRDISVEL 330
            |::..:.|||:||||:|.|..:.:.|.|::|.|.||||..||:|:|..::|:||.||.|    .|
Zfish   230 GVAFLIRDWRKLQLAISAPGFLFIFYIWVLPHSARWLLVNNRKEEAIDLLRKAASVNGR----TL 290

  Fly   331 MASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAILLLIWAVNAIVYYGL 395
            ..:.:.:..::..|:..               ..|.::.|:..:..|..||..||.||.:|||||
Zfish   291 PPTVQVERYESPQGRSK---------------YTVVDLLRTPQMRKRALILFYIWFVNVLVYYGL 340

  Fly   396 SLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSITCVASGFVTLAQGD 460
            ||..:.|..:.||...:..|||||..:|. |.|....|::.||..|::....|:    :||.   
Zfish   341 SLGVSDLGADLYLTQFMFGLVEIPARTLV-LVLLPCSRKIPLSVFLVVGGGACL----LTLT--- 397

  Fly   461 WIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRSGGVGVMSTFARF 525
             :|    .:|.|       :...|.:|||.|||:|||:||.::||:.|||:|..|:||.|.|||.
Zfish   398 -LP----ADSAH-------VRTALAMVGKFGITASFAIIYVYSAELFPTVLRQTGIGVSSMFARM 450

  Fly   526 GAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTVEE 576
            |.:|||.:.||..:...:|:|:||:..|:|..|:|.||||..:.|||::.:
Zfish   451 GGVLAPLINLLGRHTPVVPMLIFGSTPLLAAALALALPETARQPLPDSIHD 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 182/557 (33%)
MFS 158..533 CDD:119392 129/377 (34%)
si:dkey-166k12.1XP_001341287.1 2A0119 11..497 CDD:273328 181/556 (33%)
MFS 123..458 CDD:119392 129/374 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.