DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG14518

DIOPT Version :8

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster

Alignment Length:138 Identity:40/139 (29%)
Similarity:71/139 (51%) Gaps:18/139 (13%)


  Fly    12 IVYKLKNIECSTVPGFSANAS------CHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYS 70
            :::|:.|..|.|.     |.|      |.:||::.||....:|..||.|::::.::.::||:  :
  Fly    23 VIFKMTNAVCETY-----NKSWVEFGLCRLRAVSRNKVCLNVDANLLHPVHDVIVKARLLKR--A 80

  Fly    71 NKFQPFLVDVVINMCDALSRR--SFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLP 133
            |.::|:|..|..:.|..:.||  :.|   .|:.::.:.:|..||:|||.|....:..||....||
  Fly    81 NGYKPWLYSVSFDGCQFIRRRNNALI---RIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLP 142

  Fly   134 NVFPLGFY 141
            ...|.|.|
  Fly   143 TPIPTGEY 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 22/72 (31%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281510
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.