DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33644

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster


Alignment Length:140 Identity:36/140 - (25%)
Similarity:57/140 - (40%) Gaps:37/140 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKNIECST-VPGFSANASCHIRAINWNKA----VAEM----DVYLLRPLYNIT-------IRFQI 64
            :..|||.. .|.:..|.||.:...:.|..    .||.    :|..:|..|..:       |.:..
  Fly     5 MTQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSLRKEVNDVRGAYVFSFKQGKSIINYTA 69

  Fly    65 LKKDYSNKFQPFLVDVVINMCDALSR-RSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLN 128
            ::.||               |.|||. :|.|.:.||..::.|. |||..:||:   :|.:..|::
  Fly    70 MEIDY---------------CQALSALQSQILFKLIADELRRV-SNFPLNCPF---VMNKRYYVD 115

  Fly   129 ESYL-PNVFP 137
            |..: |.|.|
  Fly   116 EFTINPKVIP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 20/67 (30%)
CG33644NP_001027259.1 DUF1091 64..133 CDD:461928 23/81 (28%)

Return to query results.
Submit another query.