DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33912

DIOPT Version :8

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster

Alignment Length:154 Identity:32/154 - (20%)
Similarity:67/154 - (43%) Gaps:29/154 - (18%)


  Fly     1 MYDIFQLSEPNIVYKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQ 63
            ||.....:|...:.:..|::|.:: ..|:....|:::::|.:.....:.|.||: |:..:.|||.
  Fly    13 MYSTCYFTEVYSLVEFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLLKLPISKVKIRFG 77

  Fly    64 ILKKDYSNKFQPFLVDVVINMCDALSRRS-------FIPYGLIILKIARTFSNFNHSCPYRGHLM 121
            :.|:  ...::|||.:..::.|..|...:       ||.:.:::.|:  ::.:.|:..       
  Fly    78 LYKR--FTGYKPFLYNATLDACKFLKSPNSNPVALFFIIHDIVLDKM--SYHSVNNKL------- 131

  Fly   122 ARGAYLNESYLPNVFPLGFYKFNI 145
                   ...||  ||.|.|...|
  Fly   132 -------TKILP--FPEGHYMIEI 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 16/80 (20%)
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 19/89 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C294665
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.