DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33687

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster


Alignment Length:141 Identity:41/141 - (29%)
Similarity:66/141 - (46%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NIECSTVPGFSAN-ASCHIRAINWNKAVAEMD--VYLLRPLYNITIRFQILKKDYSNKFQPFLVD 79
            |::|..:.....| ..|.|:|:|......:::  :|:| |:.||.|:..  .|.|:|.::||.:.
  Fly    16 NLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYIL-PINNIMIKLD--SKRYTNGYRPFFMS 77

  Fly    80 VVINMCDAL---SRRSFIPYGLIILKIARTF---SNFNHSCPYRGHLMA--------RGAYLNES 130
            :..:.|..|   ::||.|    .:.:|..||   ||.||:|||...:..        ..|:|.  
  Fly    78 LTFDFCKYLKNPNQRSMI----FLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLERAFLR-- 136

  Fly   131 YLPNVFPLGFY 141
            |||  .|.|.|
  Fly   137 YLP--VPNGDY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 25/83 (30%)
CG33687NP_001027130.2 DUF1091 64..147 CDD:461928 28/90 (31%)

Return to query results.
Submit another query.