DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33626

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027405.2 Gene:CG33626 / 3772257 FlyBaseID:FBgn0053626 Length:167 Species:Drosophila melanogaster


Alignment Length:152 Identity:29/152 - (19%)
Similarity:55/152 - (36%) Gaps:23/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFQLSEPNIVYKLKNIECSTVPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKD 68
            :|..:|.....:....:|...|.::...:|.|...  .:::..:::.||..|..|.:..:|..:.
  Fly     8 VFHYTEAKRRLRWDCFDCQMGPHYADQMTCQIGGT--RRSLLNVELKLLTELDQIKVYIKISTRF 70

  Fly    69 YSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTF---SNFNHSCPY-RGHLMARGAYLN- 128
            .|........|:..:.|..:|.   :..|.::..:....   ||....||. :|.:.    |.| 
  Fly    71 KSTTLYRKFFDITFDGCRVISD---MVQGTMVSNMFNAVVKSSNQPRKCPVNKGTIY----YHNI 128

  Fly   129 --ESYLPNVFP-------LGFY 141
              |..||...|       :.||
  Fly   129 SIEDALPMFVPSAQLFIQIDFY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 17/83 (20%)
CG33626NP_001027405.2 DUF1091 62..140 CDD:284008 16/84 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.