DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33792

DIOPT Version :8

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster

Alignment Length:204 Identity:55/205 (27%)
Similarity:92/205 (45%) Gaps:45/205 (22%)


  Fly    10 PNIV-------YKLKNIECSTVPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKK 67
            ||.:       :|::..||.....:.:|.||.::.:||.::|..||..:...|.:|.:..::..|
  Fly    20 PNTIFYSNGYFFKIRKTECIANGAYFSNVSCILKPVNWTRSVLNMDGDIKEALTDIKMSVEVFYK 84

  Fly    68 DYSNKFQPFLVDVVINMCDALSRR---SFI-PYGLIILKIARTFSNFNHSCPYR----------- 117
            |.||.::||.|....::|..|..:   :|: .|.:..|   ..::|.|||||||           
  Fly    85 DSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHL---TEWTNVNHSCPYRVSLCIYNIVKF 146

  Fly   118 ------------GHLMARGAYLNESYLPNVFPLGFYK--FNITIMENYITPPSAHVGGIIWYVQA 168
                        |||:||...|:|..|| :.|:..||  ||.:...     |..|:|.::.|.:.
  Fly   147 SQYIEYIYMFLKGHLIARNFRLDEVSLP-ILPIQDYKIAFNFSGAN-----PGIHLGLVLIYFEI 205

  Fly   169 MHAIQPKKK 177
            :.....:||
  Fly   206 LEDYYKQKK 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 33/120 (28%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 32/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.