DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33641

DIOPT Version :8

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster

Alignment Length:172 Identity:41/173 (24%)
Similarity:74/173 (43%) Gaps:32/173 (18%)


  Fly    12 IVYKLKNIECSTVPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIR--FQILKKDYSNKFQ 74
            |.||        ||.......|::...| |::...:::.|.:.:.::.:|  .:..|.:..||.:
  Fly    33 IKYK--------VPDIFEKMDCNLYQAN-NRSYVNVEMKLKKEVSDLNVRAIMEFWKPNAQNKMK 88

  Fly    75 PFLVDVVINMCDAL----SRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMAR--GAYLNESYLP 133
              |.||.::.|..|    ..:.|..|    :|..:..||...|||::.:...:  ..:|:|..||
  Fly    89 --LYDVRVDGCLILRTIHKNKLFYFY----VKSFKKHSNVVLSCPFKANFTYKMDDWFLDEEELP 147

  Fly   134 NVFPLGFYKFNITIMENYITPPSAHVGGIIWYVQAMHAIQPK 175
            ...|:|.::   |:.| |.|...     :|..|.|..|:.|:
  Fly   148 PFAPVGQFR---TVTE-YFTQQR-----LIIRVVAHGAVLPR 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 24/97 (25%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.