DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33783

DIOPT Version :8

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster

Alignment Length:133 Identity:36/133 - (27%)
Similarity:58/133 - (43%) Gaps:24/133 - (18%)


  Fly    15 KLKNIECST----VPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQP 75
            :||..|...    :.|...:|..|...||.:..:..        ||.   ||        |.::|
  Fly    24 ELKRCELKVLGRGIVGLFLHAQAHQLPINSSTCILS--------LYR---RF--------NGYRP 69

  Fly    76 FLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLPNV-FPLG 139
            ||.::.:::|.....|...|:..::....:.|||.|||||:...::.....||::.:..| ||.|
  Fly    70 FLYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMVLNDNMIVKVPFPSG 134

  Fly   140 FYK 142
            |||
  Fly   135 FYK 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 23/71 (32%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 28/89 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284320
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.