DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33922

DIOPT Version :9

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:160 Identity:42/160 - (26%)
Similarity:74/160 - (46%) Gaps:23/160 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFQLSEPNIVYKLK--NIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIR--- 61
            ||..:...::.||:  ||:|.|: |.|:....|.::::|.......:.|.||: |:.|:.|.   
  Fly    12 IFLFTIHLVICKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSNVKINIAT 76

  Fly    62 FQILKKDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAY 126
            ||.|     |.::|||.:|.::.|.....:...|.........:.:||.||||||...::.....
  Fly    77 FQRL-----NGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDIILDKVS 136

  Fly   127 LN--ESYLPNVFPL---------GFYKFNI 145
            ::  .:.:.||.|:         .:|.:||
  Fly   137 ISHANTQVTNVLPVPHGNYLYRADWYAYNI 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 20/84 (24%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.