DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33922

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:160 Identity:42/160 - (26%)
Similarity:74/160 - (46%) Gaps:23/160 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFQLSEPNIVYKLK--NIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIR--- 61
            ||..:...::.||:  ||:|.|: |.|:....|.::::|.......:.|.||: |:.|:.|.   
  Fly    12 IFLFTIHLVICKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSNVKINIAT 76

  Fly    62 FQILKKDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAY 126
            ||.|     |.::|||.:|.::.|.....:...|.........:.:||.||||||...::.....
  Fly    77 FQRL-----NGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDIILDKVS 136

  Fly   127 LN--ESYLPNVFPL---------GFYKFNI 145
            ::  .:.:.||.|:         .:|.:||
  Fly   137 ISHANTQVTNVLPVPHGNYLYRADWYAYNI 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 20/84 (24%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 22/88 (25%)

Return to query results.
Submit another query.