DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33920

DIOPT Version :10

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:137 Identity:29/137 - (21%)
Similarity:61/137 - (44%) Gaps:18/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILKKDYS--NKFQ 74
            ::..||.|::: ..||....|:|:::|.:.....:...|.: |:..|.   .::.|.::  |.::
  Fly    25 FEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKIN---GVILKRFNGYNGYR 86

  Fly    75 PFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLPNVFPLG 139
            ||:.::.::.|..::.....|....:....|.|:|.||:|||...|:.           ...|:.
  Fly    87 PFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVI-----------EKLPIH 140

  Fly   140 FYKFNIT 146
            |....:|
  Fly   141 FVNHQVT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 16/74 (22%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 19/91 (21%)

Return to query results.
Submit another query.