DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33631

DIOPT Version :8

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster

Alignment Length:133 Identity:28/134 (21%)
Similarity:49/134 (37%) Gaps:39/134 (29%)


  Fly    42 KAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQPFLVDVVI------NMCDALSRRSFIPYGLII 100
            ||::.:|...|:    .|| |..|:::..:.|..|.:.:.:      |....|..|.        
  Fly    55 KALSYIDETRLK----FTI-FISLREELGSNFLTFNIKIRVRPTGRTNFVTLLQMRD-------- 106

  Fly   101 LKIARTFSNFNHS------------------CPYR-GHLMARGAYLNESYLPNVFPLGFYKFNIT 146
            |.:...|:.|..:                  ||.| |:...:...:.:.| |.|...|.|||.:.
  Fly   107 LDLCGFFTEFRKNPMMKYFLQSEMQLSDIIVCPVRVGNYSVKNVSVKDIY-PQVLQNGIYKFFVE 170

  Fly   147 IME 149
            ::|
  Fly   171 VIE 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 20/103 (19%)
CG33631NP_001027167.1 DUF1091 84..167 CDD:284008 17/92 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.