DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33467

DIOPT Version :8

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster

Alignment Length:174 Identity:67/175 (38%)
Similarity:106/175 (61%) Gaps:3/175 (2%)


  Fly     4 IFQLSEPNIVYKLKNIECSTVPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKD 68
            |..:::..:|||...:||........|.||:::.||||.|:..:|.||:.||.|.|||.|:..||
  Fly    14 IGHMTDSQLVYKFTKVECQGNQARVKNVSCNVKPINWNTALVNLDCYLIYPLINPTIRVQVFMKD 78

  Fly    69 YSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLP 133
            |||:::|||:|....:||.:.|::|:||.:::.::.:.|:|.. ||...|.|.||..|||.||:|
  Fly    79 YSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQLSARNGYLNSSYVP 142

  Fly   134 NVFPLGFYKFNITIMENYITPPSAHVGGIIWYVQAMHAIQPKKK 177
             .||.|.|:.::...::..| ....||.:.::||||..|:.||:
  Fly   143 -PFPHGQYQISVMFSDSNST-NREFVGIVKFFVQAMDEIKIKKR 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 31/91 (34%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 36/83 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280646
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.