DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33137 and CG33483

DIOPT Version :8

Sequence 1:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster

Alignment Length:138 Identity:38/139 (27%)
Similarity:68/139 (49%) Gaps:18/139 (13%)


  Fly    18 NIEC-STVPGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILKKDYSNKFQPFLVDV 80
            ||:| |....|.....||::::|.:.....:.|.|.: |:..:.:.|.:||:  .|.::|||.::
  Fly    79 NIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKR--FNGYKPFLYNI 141

  Fly    81 VINMCDALSRRSFIP-----YGLIILKIARTFSNFNHSCPYRGHLMARGA---YLNESYLPNV-F 136
            .::.|.||....:.|     |||.     :..||.||:||:...|:....   ::|:....:: |
  Fly   142 TVDACKALRHSKYNPIFSFFYGLF-----KHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKF 201

  Fly   137 PLGFYKFN 144
            |.|.|.|:
  Fly   202 PHGDYLFH 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33137NP_788343.3 DM8 73..164 CDD:214778 23/82 (28%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C295289
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.