DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and Pcgf6

DIOPT Version :10

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_001347561.1 Gene:Pcgf6 / 71041 MGIID:1918291 Length:359 Species:Mus musculus


Alignment Length:98 Identity:36/98 - (36%)
Similarity:59/98 - (60%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELNLKSDDTLRSLIY 97
            |.|.:|:||:||.||:..|.||:|:|||::|...:..||:|.....:.....|::.|..|:.::|
Mouse   135 ILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNIRLDRQLQDIVY 199

  Fly    98 KLVPGLYQRECKELADFKEQHDL-VDEQTTDEP 129
            |||..|.:||.|::.||.::..| |.:....:|
Mouse   200 KLVINLEEREKKQMHDFYKERGLEVPKPAAPQP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 RING-HC_PCGF5 23..117 CDD:438395 33/83 (40%)
RAWUL_PCGF2_like 137..228 CDD:340602
Pcgf6NP_001347561.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..116
RING-HC_PCGF6 128..186 CDD:438396 20/50 (40%)
RAWUL_PCGF6 255..350 CDD:340605
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.