DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and AT1G35183

DIOPT Version :10

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_001320761.1 Gene:AT1G35183 / 28717305 AraportID:AT1G35183 Length:122 Species:Arabidopsis thaliana


Alignment Length:105 Identity:23/105 - (21%)
Similarity:44/105 - (41%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVY--CPECKASGGKEINELNLKSDD 90
            :...|.:|.:|.......|.:..|.|.:|..||...:....:  ||.|....|.:..:: |:.||
plant     4 EMRKLYSCAICNNLFDHATALKRCNHIFCFRCIYGKITEHDWKCCPVCYVELGPDPLKI-LRHDD 67

  Fly    91 TLRSLIYKLVPGLYQRE--CKELADFKEQHDLVDEQTTDE 128
               .|:..:....:.||  .::...::|:.:...|.:.||
plant    68 ---PLLLSMESNNFIREHDVEDTGSYQEESETESESSEDE 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 RING-HC_PCGF5 23..117 CDD:438395 19/92 (21%)
RAWUL_PCGF2_like 137..228 CDD:340602
AT1G35183NP_001320761.1 RING_Ubox 9..61 CDD:473075 12/51 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.