DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and Ring1

DIOPT Version :10

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_033092.3 Gene:Ring1 / 19763 MGIID:1101770 Length:406 Species:Mus musculus


Alignment Length:115 Identity:31/115 - (26%)
Similarity:49/115 - (42%) Gaps:14/115 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLQNTHNTMESNAAMD----AASPASRDVRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCIL 61
            :.|...|.|.: .|.||    |.||     |..|..:.|.:|...:.:..|...|.|.:|..||:
Mouse    16 LSLYELHRTPQ-EAIMDGTEIAVSP-----RSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIV 74

  Fly    62 KHLLRA-VYCPECKASGGKEINELNLKSDDTLRSLIYKLVPGLYQRECKE 110
            ..|... ..||.|:.   |.:::.:|:.|....:||.|:.|...:.|..:
Mouse    75 TALRSGNKECPTCRK---KLVSKRSLRPDPNFDALISKIYPSREEYEAHQ 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 RING-HC_PCGF5 23..117 CDD:438395 22/89 (25%)
RAWUL_PCGF2_like 137..228 CDD:340602
Ring1NP_033092.3 Necessary for transcriptional repression 30..234 27/100 (27%)
RING-HC_RING1 43..112 CDD:438397 19/71 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..263
Nuclear localization signal. /evidence=ECO:0000250 201..204
Necessary for interaction with CBX2. /evidence=ECO:0000269|PubMed:9312051 230..406
RAWUL_RING1 261..400 CDD:340686
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..354
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.