DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG44251 and CG31086

Sequence 1:NP_725246.1 Gene:CG44251 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001247312.1 Gene:CG31086 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster

Alignment Length:127 Identity:52/128 (41%)
Similarity:79/128 (62%) Gaps:1/128 (1%)


  Fly   338 AVIGGHDSNMEQLLVCRAYYRGVHVPGKAIPSQGCGYIAHGGREIIEPSYQMLVGKGKYHWVPSY 402
            ||:.||||:.:.:.:.||:|....:|.|.||::|..|:|:..:|:...:|::|.| ..|.|:|:.
  Fly    18 AVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVELENYEVLSG-FNYEWLPAE 81

  Fly   403 GGNVPPGAVVAGTTPGGAPLYIGRGHYCGSLTPGVIETYNRCLQIPFGGQEIRLSNYEVLVR 464
            .|.||||||..|....|..||.|||::.||||.|.:...:.||.||:..:|:::..||||.|
  Fly    82 NGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDSEEVKIFAYEVLSR 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG44251NP_725246.1 DM9 3..73 CDD:128937
DUF3421 24..134 CDD:288732
DM9 74..144 CDD:128937
DM9 322..393 CDD:128937 20/55 (36%)
DUF3421 344..455 CDD:288732 43/111 (39%)
DM9 396..464 CDD:128937 31/68 (46%)
CG31086NP_001247312.1 DM9 3..73 CDD:128937 20/56 (36%)
DUF3421 24..134 CDD:288732 43/111 (39%)
DM9 74..143 CDD:128937 31/69 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131155406
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31649
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.