DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44251 and traip

DIOPT Version :8

Sequence 1:NP_725246.1 Gene:CG44251 / 36429 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_991170.1 Gene:traip / 402900 ZFINID:ZDB-GENE-040801-30 Length:453 Species:Danio rerio

Alignment Length:196 Identity:43/197 (22%)
Similarity:62/197 (31%) Gaps:66/197 (34%)


  Fly   221 MPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPPSF----------------TPAEVAPPPS 269
            :.:||....|...||...|.|        |.:.||....                ||..|...|.
Zfish   279 LSTPTRTNEAISRLVFESPAP--------LELKPPGHGHMTDSQEIDLNLTFDINTPEHVEKKPV 335

  Fly   270 FVPAEVTAVSVPVAPSFTPASTYNPYEAGCSSYTPAECAAPSAYDAYGYGNNYDVWVSAEPGYYY 334
            .||.::.     :.||.: :||.|                  ..:..|..|          |...
Zfish   336 QVPKKMR-----LDPSVS-SSTQN------------------TENTQGRNN----------GRVK 366

  Fly   335 SPDAVIGGHDSNMEQLLVCRAYYRGVHVPGKAIPSQGCGYIAHGGR-EIIEPS----YQMLVGKG 394
            ..|.::|....|  .||..:..:..:..|.|: .:...||...||| :.|:||    .:.||.|.
Zfish   367 DDDVMMGSLFRN--SLLFRKNAFGSMLDPCKS-GTVRSGYDGLGGRAKFIQPSPLSEIRPLVLKS 428

  Fly   395 K 395
            |
Zfish   429 K 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG44251NP_725246.1 DM9 3..73 CDD:128937
DUF3421 24..134 CDD:288732
DM9 74..144 CDD:128937
DM9 322..393 CDD:128937 18/76 (24%)
DUF3421 344..455 CDD:288732 17/58 (29%)
DM9 396..464 CDD:128937 43/197 (22%)
traipNP_991170.1 zf-RING_2 7..50 CDD:290367
Prefoldin 136..256 CDD:298833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.