DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44251 and CG10916

DIOPT Version :8

Sequence 1:NP_725246.1 Gene:CG44251 / 36429 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster

Alignment Length:134 Identity:46/135 (34%)
Similarity:68/135 (50%) Gaps:9/135 (7%)


  Fly    15 PEEAVVGGNDEDGAMIYVGRAEHEGDMLVCKVVPSKQLGFISQRGEA--LPKDIFEVL----CGQ 73
            ||.||..|.:|||...||.|..:..|:|....||.|:..|.|....|  |..|: |:|    |  
  Fly   124 PEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAFGSHSCSARTLTDDV-EILVLNDC-- 185

  Fly    74 NLVWIKCYDHVIPENAVLCGRTSLDQPVYIGRGHYEGHLIIGKISSVHRALFIAFRGAERRLDSY 138
            :..|:.......|.:|:..|.:.|.:..|.|||.|:|.|.:||:...|:.::|...|.|..:::|
  Fly   186 DYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHKVMYIPHHGQEVSVNTY 250

  Fly   139 EILV 142
            |:||
  Fly   251 EVLV 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG44251NP_725246.1 DM9 3..73 CDD:128937 24/64 (38%)
DUF3421 24..134 CDD:288732 37/116 (32%)
DM9 74..144 CDD:128937 22/70 (31%)
DM9 322..393 CDD:128937
DUF3421 344..455 CDD:288732
DM9 396..464 CDD:128937
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367
zf-rbx1 <32..74 CDD:289448
DM9 105..183 CDD:128937 23/60 (38%)
DUF3421 133..246 CDD:288732 37/116 (32%)
DM9 186..254 CDD:128937 21/68 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131155347
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31649
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.