DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44251 and CG10916

DIOPT Version :10

Sequence 1:NP_725246.1 Gene:CG44251 / 36429 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_611303.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster


Alignment Length:134 Identity:46/134 - (34%)
Similarity:68/134 - (50%) Gaps:9/134 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PEEAVVGGNDEDGAMIYVGRAEHEGDMLVCKVVPSKQLGFISQRGEA--LPKDIFEVL----CGQ 73
            ||.||..|.:|||...||.|..:..|:|....||.|:..|.|....|  |..|: |:|    |  
  Fly   124 PEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAFGSHSCSARTLTDDV-EILVLNDC-- 185

  Fly    74 NLVWIKCYDHVIPENAVLCGRTSLDQPVYIGRGHYEGHLIIGKISSVHRALFIAFRGAERRLDSY 138
            :..|:.......|.:|:..|.:.|.:..|.|||.|:|.|.:||:...|:.::|...|.|..:::|
  Fly   186 DYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHKVMYIPHHGQEVSVNTY 250

  Fly   139 EILV 142
            |:||
  Fly   251 EVLV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44251NP_725246.1 DUF3421 26..134 CDD:463390 36/113 (32%)
DUF3421 345..455 CDD:463390
CG10916NP_611303.1 RING-H2_TRAIP 31..74 CDD:438143
DUF3421 135..247 CDD:463390 36/114 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.