DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG44251 and CG32633

Sequence 1:NP_725246.1 Gene:CG44251 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001259517.1 Gene:CG32633 FlyBaseID:FBgn0052633 Length:285 Species:Drosophila melanogaster

Alignment Length:462 Identity:114/463 (25%)
Similarity:166/463 (36%) Gaps:181/463 (39%)


  Fly     3 YKWVQSSAYSSLPEEAVVGGNDEDGAMIYVGRAEHEGDMLVCKVVPSKQLGFISQRGEALPKDIF 67
            ::|:..| ..|:|..|||.|:|.||..||||||....|||..||:|:|...:::...|....:.:
  Fly     4 HRWMHFS-NGSVPPNAVVAGHDSDGDTIYVGRAFFSNDMLPAKVIPNKGKAYVAYAREEHELENY 67

  Fly    68 EVLCGQNLVWIKCYDHVIPENAVLCGRTSLDQPVYIGRGHYEGHLIIGKISSVHRALFIAFRGAE 132
            |||.|.|..|:...:..:|..||..||....:.:|.|||::.|.|.:||:...|..|:|.:...|
  Fly    68 EVLSGYNYEWLSAENGEVPPGAVKVGRNVDGEYLYAGRGYHAGSLTMGKVHPSHGCLYIPYDSDE 132

  Fly   133 RRLDSYEILVEERRVVPGWQLPPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMP 197
            .::.:||:|.:..|    |                                              
  Fly   133 VKIFAYEVLCQPER----W---------------------------------------------- 147

  Fly   198 FPDRPPAYTPTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPPSFTPA 262
                                                                             
  Fly   148 ----------------------------------------------------------------- 147

  Fly   263 EVAPPPSFVPAEVTAVSVPVAPSFTPASTYNPYEAGCSSYTPAECAAPSAYDAYGYGNNYDVWVS 327
                      .:.||.::|                                              
  Fly   148 ----------IDTTATNIP---------------------------------------------- 156

  Fly   328 AEPGYYYSPDAVIGGHDSNMEQLLVCRAYYRGVHVPGKAIPSQGCGYIAHGGREIIEPSYQMLVG 392
                    ..|::.|||||.:.:.|.|.:..|..:|.|.:|::|..|.|:...|......|:|.|
  Fly   157 --------DGALVAGHDSNGDTIYVGRVFRNGDLLPAKVVPAKGKAYAAYAQAEHELTDVQVLTG 213

  Fly   393 KGKYHWVPSYGGNVPPGAVVAGTTPGGAPLYIGRGHYCGSLTPGVIETYNRCLQIPFGGQEIRLS 457
            .| :.|||:..|||.|||:.:|....|.|||:||..||.||:.|.|...:.|:.|||||:|:||.
  Fly   214 SG-FRWVPASHGNVAPGALSSGPNVDGEPLYVGRAIYCDSLSVGKIHPSHGCIYIPFGGEEVRLE 277

  Fly   458 NYEVLVR 464
            |||||||
  Fly   278 NYEVLVR 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG44251NP_725246.1 DM9 3..73 CDD:128937 29/70 (41%)
DUF3421 24..134 CDD:288732 40/110 (36%)
DM9 74..144 CDD:128937 22/70 (31%)
DM9 322..393 CDD:128937 19/71 (27%)
DUF3421 344..455 CDD:288732 46/111 (41%)
DM9 396..464 CDD:128937 37/68 (54%)
CG32633NP_001259517.1 DM9 3..73 CDD:128937 29/70 (41%)
DUF3421 24..134 CDD:288732 40/110 (36%)
DM9 74..142 CDD:128937 22/68 (32%)
DUF3421 165..275 CDD:288732 46/111 (41%)
DM9 215..284 CDD:128937 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131155445
eggNOG 1 0.900 E1_28P3B
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31649
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.