DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG44251 and Traip

Sequence 1:NP_725246.1 Gene:CG44251 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_035764.2 Gene:Traip MGIID:1096377 Length:470 Species:Mus musculus

Alignment Length:183 Identity:40/184 (22%)
Similarity:66/184 (36%) Gaps:50/184 (27%)


  Fly    34 RAEHEGDMLVCKVVPSKQLGFI--SQRGEALPKDIFEVLCGQNLVWIKCYDHVIPENAVLCGRTS 96
            :|..|...|.||:...:|:..:  |||.| :.:.|.::..||:         .:.:.||.|  .|
Mouse   151 QAREEAHRLKCKMKTMEQIELLLQSQRSE-VEEMIRDMGVGQS---------AVEQLAVYC--VS 203

  Fly    97 LDQPVYIGRGHYE---------GHLI----------IGKISSVHRAL---FIAFRGAERRLDSYE 139
            |       :..||         |.|.          ..|:.:::..|   .:..|.|::.|.|.:
Mouse   204 L-------KKEYENLKEARKATGELADRLKKDLVSSRSKLKTLNTELDQAKLELRSAQKDLQSAD 261

  Fly   140 ILVEERR----VVPGWQLPPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPY 188
            ..:...|    ::.| .|..||...|...:.....|.|..  .|.|.|...|:
Mouse   262 QEITSLRKKLMILQG-TLSLPPATNETVSRLVFESPAPVE--MMNPRLHQPPF 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG44251NP_725246.1 DM9 3..73 CDD:128937 12/41 (29%)
DUF3421 24..134 CDD:288732 26/124 (21%)
DM9 74..144 CDD:128937 15/92 (16%)
DM9 322..393 CDD:128937
DUF3421 344..455 CDD:288732
DM9 396..464 CDD:128937
TraipNP_035764.2 zf-RING_2 7..50 CDD:290367
BRE1 204..>271 CDD:285810 12/74 (16%)
Interaction with CYLD. {ECO:0000250} 211..470 20/105 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.