DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mdr49 and ABCC10

Sequence 1:NP_523724.2 Gene:Mdr49 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:XP_016866934.1 Gene:ABCC10 HGNCID:52 Length:1558 Species:Homo sapiens

Alignment Length:1346 Identity:318/1347 (24%)
Similarity:556/1347 (41%) Gaps:282/1347 (21%)


  Fly    66 IYGEF----TSLLVDRTVG--VGTSSPAFALPMFGGGQQLTNASKEENNQAIIDDATAFGIGSLV 124
            :||.|    .:|.:.:.||  :|.|.|.....:.|         ..|..|..:.....:.:|...
Human   328 LYGAFGRCYLALGLLKLVGTMLGFSGPLLLSLLVG---------FLEEGQEPLSHGLLYALGLAG 383

  Fly   125 GSVAMFLL----------ITLAIDLANRIALN-------QIDRIRKLFLEAMLRQDIAWYDTSSG 172
            |:|...:|          :||.   |....||       |:...|....||:   ::...|:...
Human   384 GAVLGAVLQNQYGYEVYKVTLQ---ARGAVLNILYCKALQLGPSRPPTGEAL---NLLGTDSERL 442

  Fly   173 SNFASKMTEDLDKLKEGIGEKIVIVVFLIMTFVIGIVSAFVYGWKLTLVVLSCVPF-IIAATSVV 236
            .|||....|     ..|:..::.|.::|:.. .:|:  |||.|..|.|::   ||. .:.||.::
Human   443 LNFAGSFHE-----AWGLPLQLAITLYLLYQ-QVGV--AFVGGLILALLL---VPVNKVIATRIM 496

  Fly   237 ARLQGSLAEKELKSYSDAANVVEEVFSGIRTVFAFSGQEKEKERFGKLL--IPAENTGRKKGL-Y 298
            |..|..|..|:.:     ..:|.|:.|||| |..|.|.|   :..|..:  ..|...||.:.: |
Human   497 ASNQEMLQHKDAR-----VKLVTELLSGIR-VIKFCGWE---QALGARVEACRARELGRLRVIKY 552

  Fly   299 SGMGNALSWLIIYLCMALAIWYGVTLILDERDL-PDRVYTPAVLVIVLFAVIMGAQNLGFASPHV 362
            ........|..:.:.:::.|:  :|.:|....| ..:|:|...||.:|   |:...|..:.   :
Human   553 LDAACVYLWAALPVVISIVIF--ITYVLMGHQLTATKVFTALALVRML---ILPLNNFPWV---I 609

  Fly   363 EAIAVATAAGQTLFNIIDRP----------------SQV------DPMDEKGNRPENTAGHIRFE 405
            ..:..|..:...:...:|.|                :|:      ||       |...:..:...
Human   610 NGLLEAKVSLDRIQLFLDLPNHNPQAYYSPDCGRLGAQIKWLLCSDP-------PAEPSTVLELH 667

  Fly   406 GIRFRY-PARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSV-KLDGR-D 467
            |..|.: |....:|.... .::|..|..|..||..|||||:|:..:       ||.: :|.|. .
Human   668 GALFSWDPVGTSLETFIS-HLEVKKGMLVGIVGKVGCGKSSLLAAI-------AGELHRLRGHVA 724

  Fly   468 LRTLNVGWLRSQIGVVGQEPVLFATTIGENIRYGRPSATQADIEKAARAANCHDFITRLPKGYDT 532
            :|.|:.|:     |:..|||.:...||.:||.:|:....|. .::...|...:|.::.||.|..|
Human   725 VRGLSKGF-----GLATQEPWIQFATIRDNILFGKTFDAQL-YKEVLEACALNDDLSILPAGDQT 783

  Fly   533 QVGEKGAQISGGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTT-LVVA 596
            :|||||..:||||:.|||:|||:.::.::.|||:..:|:|......:.....|.....|| |:..
Human   784 EVGEKGVTLSGGQRARIALARAVYQEKELYLLDDPLAAVDADVANHLLHRCILGMLSYTTRLLCT 848

  Fly   597 HRLSTITNADKIVFLKDGVVAEQGTHEELMERRGLYCELVSITQRKEATEADEGAVAGRPLQKSQ 661
            ||...:..||.::.::.|          .:.|.|...|::.:.|......|:.|       |:|.
Human   849 HRTEYLERADAVLLMEAG----------RLIRAGPPSEILPLVQAVPKAWAENG-------QESD 896

  Fly   662 NLSDEETDDDEEDEEEDEEPELQTSG-----SSRDSGFRA------------------------- 696
            :.:.:...:.|:.:|..|| |..|||     .|:..|..|                         
Human   897 SATAQSVQNPEKTKEGLEE-EQSTSGRLLQEESKKEGAVALHVYQAYWKAVGQGLALAILFSLLL 960

  Fly   697 --STRRKRR-------SQRRKKKKDKEVVSKVS------FTQLMKLNSPEWRFIVVGGIASVMHG 746
              :||....       ||.:.:...:|.....|      |:..:.|.||...:|.|         
Human   961 MQATRNAADWWLSHWISQLKAENSSQEAQPSTSPASMGLFSPQLLLFSPGNLYIPV--------- 1016

  Fly   747 ATFPLWGLFFGDFFGILSDGDDDVVRAEVLKISMIFVGIGLMAGLGNMLQTYMFTTAGVKMTTRL 811
              |||        .....:|..|:  ...|.:.....|:.   .|..:|:..:|....::....|
Human  1017 --FPL--------PKAAPNGSSDI--RFYLTVYATIAGVN---SLCTLLRAVLFAAGTLQAAATL 1066

  Fly   812 RKRAFGTIIGQDIAYFDDERNSVGALCSRLASDCSNVQGATGARVGTMLQAVATLVVGM--VVGF 874
            .:|....::...:.:|:  ....|.:.:|.:||.:....:....:..:|...|.| :|:  |:|.
Human  1067 HRRLLHRVLMAPVTFFN--ATPTGRILNRFSSDVACADDSLPFILNILLANAAGL-LGLLAVLGS 1128

  Fly   875 VFSWQQTLLTLVTLPLVCLSVYLEGRFIMKSAQKAKASIEEASQVAVEAITNI-----RTVNGLC 934
            ...|    |.|:..||..:..:::..:        :||..|..::....::.:     .|:.||.
Human  1129 GLPW----LLLLLPPLSIMYYHVQRHY--------RASSRELRRLGSLTLSPLYSHLADTLAGLS 1181

  Fly   935 LERQVLDQY---------VQQIDRVDIACRRKVRFRGLVFALGQAAPFLAYGISMYYGGILVAEE 990
            :.|.....|         ::...|...|....:::..:...|..||...|      ..||.:.:.
Human  1182 VLRATGATYRFEEENLRLLELNQRCQFATSATMQWLDIRLQLMGAAVVSA------IAGIALVQH 1240

  Fly   991 RMNYEDIIKVAEALIFGSWMLGQALAYAPNVNDAILSAGRLMDLFKRTSTQ-------------- 1041
            :..           :....::|.:|:||.::. .:||.  |:..|.:|...              
Human  1241 QQG-----------LANPGLVGLSLSYALSLT-GLLSG--LVSSFTQTEAMLVSVERLEEYTCDL 1291

  Fly  1042 PNPPQS---PYNTVEKSEGDIVYENVGFEYPTRKGTP-ILQGLNLTIKKSTTVALVGPSGSGKST 1102
            |..||.   ...|...::|.:.:::|...|  |.|.| .|.|:...::....:.:||.:|||||:
Human  1292 PQEPQGQPLQLGTGWLTQGGVEFQDVVLAY--RPGLPNALDGVTFCVQPGEKLGIVGRTGSGKSS 1354

  Fly  1103 CVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIAENIAYGNNFRDDVSM 1167
            .:.:|.|..:|.||.|.|.||.:::..|..|||:|.::.|||.||..|:.||:......:|    
Human  1355 LLLVLFRLLEPSSGRVLLDGVDTSQLELAQLRSQLAIIPQEPFLFSGTVRENLDPQGLHKD---- 1415

  Fly  1168 QEIIEAAKKSNIHNFISALPQGYDTRLGKTSQ-LSGGQKQRIAIARALVRNPKILILDEATSALD 1231
            :.:.:|.|:.::...|::: .|.|..||:..: ||.||:|.:.:||||:.:.|||.:||||:::|
Human  1416 RALWQALKQCHLSEVITSM-GGLDGELGEGGRSLSLGQRQLLCLARALLTDAKILCIDEATASVD 1479

  Fly  1232 LESEKVVQQALDEARSGRTCLTIAHRLTTVRNADLICVLKRGVVVE 1277
            .::::::||.:.:..:.:|.|||||||.|:.|:|.:.||:.|.|||
Human  1480 QKTDQLLQQTICKRFANKTVLTIAHRLNTILNSDRVLVLQAGRVVE 1525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 34..640 CDD:224055 152/628 (24%)
ABC_membrane 116..352 CDD:279056 62/258 (24%)
ABC_MTABC3_MDL1_MDL2 402..636 CDD:213216 70/238 (29%)
MdlB 735..1299 CDD:224055 140/579 (24%)
ABC_membrane 739..998 CDD:279056 44/275 (16%)
ABC_MTABC3_MDL1_MDL2 1059..1298 CDD:213216 80/222 (36%)
ABCC10XP_016866934.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.