DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mdr49 and ABCB12

Sequence 1:NP_523724.2 Gene:Mdr49 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_171754.1 Gene:ABCB12 AraportID:AT1G02530 Length:1273 Species:Arabidopsis thaliana

Alignment Length:1301 Identity:470/1302 (36%)
Similarity:724/1302 (56%) Gaps:105/1302 (8%)


  Fly    32 FDLFRYSTRCERFLLVVSLLVATAASAFIPYFMIIYGEFTSLLVDRTVGVGTSSPAFALPMFGGG 96
            :.||.::...:.||::...|.|......:|...:::|:    |:|               .||  
plant    31 YKLFAFADSFDVFLMICGSLGAIGNGVCLPLMTLLFGD----LID---------------SFG-- 74

  Fly    97 QQLTNASKEENNQAIIDDATA-------FGIGSLVGSVAMFLLITLAIDLANRIALNQIDRIRKL 154
                   |.:||:.|:|..:.       .|:|.|   .|.||.:...:....|    |..:||..
plant    75 -------KNQNNKDIVDVVSKVCLKFVYLGLGRL---GAAFLQVACWMITGER----QAAKIRSN 125

  Fly   155 FLEAMLRQDIAWYD--TSSGSNFASKMTEDLDKLKEGIGEKIVIVVFLIMTFVIGIVSAFVYGWK 217
            :|:.:|||||.::|  |::| ....:|:.|...:::.:|||:...:.|:.|||.|...||..||.
plant   126 YLKTILRQDIGFFDVETNTG-EVVGRMSGDTVHIQDAMGEKVGKFIQLVSTFVGGFALAFAKGWL 189

  Fly   218 LTLVVLSCVPFIIAATSVVARLQGSLAEKELKSYSDAANVVEEVFSGIRTVFAFSGQEKEKERFG 282
            ||||:|:.:||:..|.:.:|.|....:.:...:|:.||.|||:....||||.:|:|:::....:.
plant   190 LTLVMLTSIPFLAMAGAAMALLVTRASSRGQAAYAKAATVVEQTIGSIRTVASFTGEKQAINSYK 254

  Fly   283 KLLIPAENTGRKKGLYSGMGNALSWLIIYLCMALAIWYGVTLILDERDLPDRVYTPAVLVIVLFA 347
            |.:..|..:..::|..:|:|..:...:.:...|||||:|..:||      ::.||...::.|:..
plant   255 KYITSAYKSSIQQGFSTGLGLGVMIYVFFSSYALAIWFGGKMIL------EKGYTGGSVINVIII 313

  Fly   348 VIMGAQNLGFASPHVEAIAVATAAGQTLFNIIDRPSQVDPMDEKGNRPENTAGHIRFEGIRFRYP 412
            |:.|:.:||..||.|.|.|...||...:|..|.|...:|..|..|....:..|.|..:.:.|.||
plant   314 VVAGSMSLGQTSPCVTAFAAGQAAAYKMFETIKRKPLIDAYDVNGKVLGDIRGDIELKDVHFSYP 378

  Fly   413 ARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDLRTLNVGWLR 477
            ||||.||..|.::.:..|.|.|.||.||.||||:|.|::|||||:||.|.:||.:|:...:.|:|
plant   379 ARPDEEIFDGFSLFIPSGATAALVGESGSGKSTVINLIERFYDPKAGEVLIDGINLKEFQLKWIR 443

  Fly   478 SQIGVVGQEPVLFATTIGENIRYGRPSATQADIEKAARAANCHDFITRLPKGYDTQVGEKGAQIS 542
            |:||:|.||||||:::|.|||.||:.:||..:|:.|...||...||..||:|.||:|||.|.|:|
plant   444 SKIGLVCQEPVLFSSSIMENIAYGKENATLQEIKVATELANAAKFINNLPQGLDTKVGEHGTQLS 508

  Fly   543 GGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHRLSTITNADK 607
            ||||||||||||:::.|:||||||||||||..||:.||.||:......||:||||||||:.|||.
plant   509 GGQKQRIAIARAILKDPRVLLLDEATSALDTESERVVQEALDRVMVNRTTVVVAHRLSTVRNADM 573

  Fly   608 IVFLKDGVVAEQGTHEELM-ERRGLYCELVSITQRKEATEADEGAVAGRPLQKSQNLSDEETDDD 671
            |..:..|.:.|:|:|.||: :..|.|.:|:...:..:..:|....:|.....::.||:       
plant   574 IAVIHSGKMVEKGSHSELLKDSVGAYSQLIRCQEINKGHDAKPSDMASGSSFRNSNLN------- 631

  Fly   672 EEDEEEDEEPELQTSG------SSRD---------SGFRASTRRKRRSQRRKKKKDKEVVSKVSF 721
                 ...|..:.:.|      |||.         :|....:..:|..|.......:|.:.|||.
plant   632 -----ISREGSVISGGTSSFGNSSRHHSLNVLGLFAGLDLGSGSQRVGQEETGTTSQEPLRKVSL 691

  Fly   722 TQLMKLNSPEWRFIVVGGIASVMHGATFPLWGLFFG----DFFGILSDGDDDVVRAEVLKISMIF 782
            |::..||.||...:::|.:.:.::||.|||:|:...    .||     ...|.::.:....::||
plant   692 TRIAALNKPEIPVLLLGTVVAAINGAIFPLFGILISRVIEAFF-----KPADQLKKDSRFWAIIF 751

  Fly   783 VGIGLMAGLGNMLQTYMFTTAGVKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDCSN 847
            |.:|:.:.:.:..|.|:|..||.|:..|::...|...:..::::||:..||.|.:.:||::|.:.
plant   752 VALGVTSLIVSPSQMYLFAVAGGKLIRRIQSMCFEKAVHMEVSWFDEPENSSGTMGARLSTDAAL 816

  Fly   848 VQGATGARVGTMLQAVATLVVGMVVGFVFSWQQTLLTLVTLPLVCLSVYLEGRFIMKSAQKAKAS 912
            ::...|..:...:|..|:...|:::.|..||:..|:.||.|||:.::.:|:.:|:...:..||:.
plant   817 IRALVGDALSLAVQNAASAASGLIIAFTASWELALIILVMLPLIGINGFLQVKFMKGFSADAKSK 881

  Fly   913 IEEASQVAVEAITNIRTVNGLCLERQVLDQYVQQIDRVDIACRRKVR-------FRGLVFALGQA 970
            .|||||||.:|:.:||||...|.|.:|:..|.:|       |...::       ..||.|.....
plant   882 YEEASQVANDAVGSIRTVASFCAEEKVMQMYNKQ-------CEGPIKDGVKQGFISGLGFGFSFF 939

  Fly   971 APFLAYGISMYYGGILVAEERMNYEDIIKVAEALIFGSWMLGQALAYAPNVNDAILSAGRLMDLF 1035
            ..|..|..|.|....||.:.:..:.|:.:|..||...:..:.|:..:||:.:.|.::|..:..:.
plant   940 ILFCVYATSFYAAARLVEDGKTTFIDVFQVFFALTMAAIGISQSSTFAPDSSKAKVAAASIFAII 1004

  Fly  1036 KRTSTQPNPPQSPYNTVEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKSTTVALVGPSGSGK 1100
            .|.|...:..::. ..:|..:|||...::.|.||.|.|..|.:.|.|||:...||||||.|||||
plant  1005 DRKSKIDSSDETG-TVLENVKGDIELRHLSFTYPARPGIQIFRDLCLTIRAGKTVALVGESGSGK 1068

  Fly  1101 STCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIAENIAYGNNFRDDV 1165
            ||.:.||.|:|||.||.:.|.||...:..|..||.::|||.||||||:.||..|||||....:..
plant  1069 STVISLLQRFYDPDSGQITLDGVELKKLQLKWLRQQMGLVGQEPVLFNDTIRANIAYGKGSEEAA 1133

  Fly  1166 SMQEIIEAAKKSNIHNFISALPQGYDTRLG-KTSQLSGGQKQRIAIARALVRNPKILILDEATSA 1229
            :..|||.||:.:|.|.|||::.|||||.:| |..|||||||||:|||||:|:.||||:|||||||
plant  1134 TESEIIAAAELANAHKFISSIQQGYDTVVGEKGIQLSGGQKQRVAIARAIVKEPKILLLDEATSA 1198

  Fly  1230 LDLESEKVVQQALDEARSGRTCLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALN-KIYAN 1293
            ||.|||::||.|||.....||.:.:||||:|::|||:|.::|.||:.|:|||:.|:.:: .:||:
plant  1199 LDAESERLVQDALDRVIVNRTTVVVAHRLSTIKNADVIAIVKNGVIAENGTHETLIKIDGGVYAS 1263

  Fly  1294 L 1294
            |
plant  1264 L 1264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 34..640 CDD:224055 232/616 (38%)
ABC_membrane 116..352 CDD:279056 73/245 (30%)
ABC_MTABC3_MDL1_MDL2 402..636 CDD:213216 126/235 (54%)
MdlB 735..1299 CDD:224055 217/574 (38%)
ABC_membrane 739..998 CDD:279056 74/270 (27%)
ABC_MTABC3_MDL1_MDL2 1059..1298 CDD:213216 129/239 (54%)
ABCB12NP_171754.1 PTZ00265 3..1267 CDD:240339 470/1302 (36%)
ABC_membrane 50..303 CDD:279056 82/295 (28%)
ABC_MTABC3_MDL1_MDL2 368..606 CDD:213216 126/238 (53%)
ABC_membrane 709..978 CDD:279056 77/281 (27%)
ABC_MTABC3_MDL1_MDL2 1027..1267 CDD:213216 129/239 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 876 1.000 Inparanoid score I58
OMA 1 1.010
OrthoDB 1 1.010 D186078at2759
OrthoInspector 1 1.000 T32146
orthoMCL 1 0.900 OOG5_126596
Panther 1 1.100 O PTHR24221
Phylome 1 0.910 0.889 Consistency score
87.980

Return to query results.
Submit another query.