DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mdr49 and ABCB2

Sequence 1:NP_523724.2 Gene:Mdr49 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_194326.2 Gene:ABCB2 AraportID:AT4G25960 Length:1273 Species:Arabidopsis thaliana

Alignment Length:1292 Identity:451/1293 (35%)
Similarity:707/1293 (55%) Gaps:101/1293 (8%)


  Fly    28 KYSYFDLFRYSTRCERFLLVVSLLVATAASAFIPYFMIIYGEFTSLLVDRTVGVGTSSPAFALPM 92
            |.|...||.::...:..|:.:..:.|....|.:|.|.|.:|:..::     :|:     |:..| 
plant    59 KVSLLKLFSFADFYDCVLMTLGSVGACIHGASVPIFFIFFGKLINI-----IGL-----AYLFP- 112

  Fly    93 FGGGQQLTNASKEENNQAIIDDATAFGIGSLVGSVAMFLLITLAIDLANRIALNQIDRIRKLFLE 157
                       |:.:::     ...:.:..:..|||:.....|.:.........|..::|:.:|.
plant   113 -----------KQASHR-----VAKYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLR 161

  Fly   158 AMLRQDIAWYDT-SSGSNFASKMTEDLDKLKEGIGEKIVIVVFLIMTFVIGIVSAFVYGWKLTLV 221
            :||.|||:.:|| :|.....|.:|.|:..:::.:.||:...:..|..|:.|....|...|:::||
plant   162 SMLSQDISLFDTEASTGEVISAITSDILVVQDALSEKVGNFLHYISRFIAGFAIGFTSVWQISLV 226

  Fly   222 VLSCVPFIIAATSVVARLQGSLAEKELKSYSDAANVVEEVFSGIRTVFAFSGQEKEKERFGKLLI 286
            .||.||.|..|..:.|.:...|..:..|||..|..:.|||...:|||.||:|:|:....:.:.| 
plant   227 TLSIVPLIALAGGIYAFVAIGLIARVRKSYIKAGEIAEEVIGNVRTVQAFTGEERAVRLYREAL- 290

  Fly   287 PAENT---GRKKGLYSGMGNALSWLIIYLCMALAIWYGVTLILDERDLPD--RVYTPAVLVIVLF 346
              |||   |||.||..|:|......:::|..||.:|:  |.::..:|:.|  :.:|      .:.
plant   291 --ENTYKYGRKAGLTKGLGLGSMHCVLFLSWALLVWF--TSVVVHKDIADGGKSFT------TML 345

  Fly   347 AVIMGAQNLGFASPHVEAIAVATAAGQTLFNIIDRPSQVDPMDEKGNRPENTAGHIRFEGIRFRY 411
            .|::...:||.|:|.:.|...|.||...:|.:|:|.:......:.|.:.....|||:|:...|.|
plant   346 NVVIAGLSLGQAAPDISAFVRAKAAAYPIFKMIERNTVTKTSAKSGRKLGKVDGHIQFKDATFSY 410

  Fly   412 PARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDLRTLNVGWL 476
            |:||||.|...|.:.:..|:.||.||.||.||||:|.|::|||:|.:|:|.|||.::..|::.||
plant   411 PSRPDVVIFDRLNLAIPAGKIVALVGGSGSGKSTVISLIERFYEPISGAVLLDGNNISELDIKWL 475

  Fly   477 RSQIGVVGQEPVLFATTIGENIRYGRPSATQADIEKAARAANCHDFITRLPKGYDTQVGEKGAQI 541
            |.|||:|.|||.||||||.|||.||:..||..:|.:||:.:....||..||:|::|||||:|.|:
plant   476 RGQIGLVNQEPALFATTIRENILYGKDDATAEEITRAAKLSEAISFINNLPEGFETQVGERGIQL 540

  Fly   542 SGGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHRLSTITNAD 606
            ||||||||||:||:|:.|.:|||||||||||..|||.||.||:....|.||:||||||||:.|||
plant   541 SGGQKQRIAISRAIVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNAD 605

  Fly   607 KIVFLKDGVVAEQGTHEELMER-RGLYCELVSITQRKEATEADEGAVAGRPLQKSQNLSDEETDD 670
            .|..:.:|.:.|.|.||.|:.. .|.|..|:.:   :|...........|.|.:..::.      
plant   606 IIAVVHEGKIVEFGNHENLISNPDGAYSSLLRL---QETASLQRNPSLNRTLSRPHSIK------ 661

  Fly   671 DEEDEEEDEEPELQTSGSSRD-SGFRASTRRKRRSQRRKKKKDKEVVSKVSFTQLMKLNSPEWRF 734
                             .||: |..|:|...:|.|..|....|.....||:..:|..:..|:|.:
plant   662 -----------------YSRELSRTRSSFCSERESVTRPDGADPSKKVKVTVGRLYSMIRPDWMY 709

  Fly   735 IVVGGIASVMHGATFPLWGLFFGDFFGILSDGDDDVVRAEVLKISMIFVGIGLMAGLGNMLQTYM 799
            .|.|.|.:.:.|:..||:.|...........|.|: .:.|:.||:::|....::..:...::...
plant   710 GVCGTICAFIAGSQMPLFALGVSQALVSYYSGWDE-TQKEIKKIAILFCCASVITLIVYTIEHIC 773

  Fly   800 FTTAGVKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDCSNVQGATGARVGTMLQAVA 864
            |.|.|.::|.|:|:..|..|:..:|.:||:..|:...|.|||.||.:.::.....|...:||.:.
plant   774 FGTMGERLTLRVRENMFRAILKNEIGWFDEVDNTSSMLASRLESDATLLKTIVVDRSTILLQNLG 838

  Fly   865 TLVVGMVVGFVFSWQQTLLTLVTLPLVCLSVYLEGRFIMK--SAQKAKASIEEASQVAVEAITNI 927
            .:|...::.|:.:|:.||:.|.|.||| :|.::..:..|:  .....||.: :|:.:|.|:::||
plant   839 LVVTSFIIAFILNWRLTLVVLATYPLV-ISGHISEKLFMQGYGGDLNKAYL-KANMLAGESVSNI 901

  Fly   928 RTVNGLCLERQVLDQYVQQIDRVDIACRRKVRFRGLVFALGQAAPFLAYGISMYYGGILVAEERM 992
            |||...|.|.::|:.|.:::.....:..|:.:..||.:.:.|...|.:||::::||..|:.:...
plant   902 RTVAAFCAEEKILELYSRELLEPSKSSFRRGQIAGLFYGVSQFFIFSSYGLALWYGSTLMDKGLA 966

  Fly   993 NYEDIIKVAEALIFGSWMLGQALAYAPNV---NDAILSAGRLMD----LFKRTSTQPNPPQSPYN 1050
            .::.::|....||..:..:|:.||.||::   |..:.|...::|    :...||.:.|       
plant   967 GFKSVMKTFMVLIVTALAMGETLALAPDLLKGNQMVASVFEILDRKTQIVGETSEELN------- 1024

  Fly  1051 TVEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKSTTVALVGPSGSGKSTCVQLLLRYYDPVS 1115
               ..||.|..:.|.|.||:|....|.:..:|.::...::||||.||||||:.:.|:||:|||.:
plant  1025 ---NVEGTIELKGVHFSYPSRPDVVIFRDFDLIVRAGKSMALVGQSGSGKSSVISLILRFYDPTA 1086

  Fly  1116 GSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIAENIAYGNNFRDDVSMQEIIEAAKKSNIH 1180
            |.|.:.|....:..|..||..:|||.|||.||..||.|||.|||   :..|..|::|:|..:|.|
plant  1087 GKVMIEGKDIKKLDLKALRKHIGLVQQEPALFATTIYENILYGN---EGASQSEVVESAMLANAH 1148

  Fly  1181 NFISALPQGYDTRLGKTS-QLSGGQKQRIAIARALVRNPKILILDEATSALDLESEKVVQQALDE 1244
            :||::||:||.|::|:.. |:||||:||||||||:::||.||:|||||||||:|||:|||||||.
plant  1149 SFITSLPEGYSTKVGERGVQMSGGQRQRIAIARAILKNPAILLLDEATSALDVESERVVQQALDR 1213

  Fly  1245 ARSGRTCLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALNKI--YANLYLMQQ 1299
            ..:.||.:.:||||:|::|||.|.||..|.:||.|:|.:|: |||.  |..|..:||
plant  1214 LMANRTTVVVAHRLSTIKNADTISVLHGGKIVEQGSHRKLV-LNKSGPYFKLISLQQ 1269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 34..640 CDD:224055 224/613 (37%)
ABC_membrane 116..352 CDD:279056 69/242 (29%)
ABC_MTABC3_MDL1_MDL2 402..636 CDD:213216 128/235 (54%)
MdlB 735..1299 CDD:224055 207/576 (36%)
ABC_membrane 739..998 CDD:279056 68/261 (26%)
ABC_MTABC3_MDL1_MDL2 1059..1298 CDD:213216 120/242 (50%)
ABCB2NP_194326.2 PTZ00265 76..1269 CDD:240339 446/1274 (35%)
ABC_membrane 86..349 CDD:279056 78/301 (26%)
ABC_MTABC3_MDL1_MDL2 401..639 CDD:213216 128/241 (53%)
ABC_membrane 714..983 CDD:279056 71/272 (26%)
ABC_MTABC3_MDL1_MDL2 1030..1268 CDD:213216 120/242 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H69084
Inparanoid 1 1.050 876 1.000 Inparanoid score I58
OMA 1 1.010
OrthoDB 1 1.010 D186078at2759
OrthoInspector 1 1.000 T32146
orthoMCL 1 0.900 OOG5_126596
Panther 1 1.100 O PTHR24221
Phylome 1 0.910 0.889 Consistency score
98.980

Return to query results.
Submit another query.