DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mdr49 and abcc13

Sequence 1:NP_523724.2 Gene:Mdr49 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:XP_017209479.1 Gene:abcc13 ZFINID:ZDB-GENE-050517-26 Length:1020 Species:Danio rerio

Alignment Length:1181 Identity:211/1182 (18%)
Similarity:420/1182 (36%) Gaps:282/1182 (24%)


  Fly   219 TLVVLSCVPFIIAATSVVARLQGSLAEKE-LKSYS-DAANVVEEVFSGIRTVFAFSGQEKEKERF 281
            ||......|.:.....||...:|.|...: ||.|: |:.:.:..||.        ...||::..:
Zfish    14 TLYCFQTSPVLYNMRMVVMGHRGPLQLFDLLKLYNEDSVHTLCSVFD--------HEWEKQQNNY 70

  Fly   282 GKLLIPAENTGRKKGLYSGMGNALSWLIIYLCMALAIW-------YGVTLILDERDLPDRVYTPA 339
            .:.....:::|||..|.:...|| .:.::|     .:|       ..:.|:....||...:....
Zfish    71 KERSDLEDDSGRKSLLVTSKTNA-GYSLLY-----TLWKTFHPSLIKIVLLRLSSDLFSILVPIT 129

  Fly   340 VLVIVLFA---------------VIMGAQNLGFASPH--------VEAIAVATAAGQTLFNIIDR 381
            :..::||:               |:.||...|..|.|        :.|.|.|..:| |::..|..
Zfish   130 IRWVILFSERQAMFGWTGYTYALVVFGALCCGAFSQHHFEKRSRIITANAHAILSG-TVYRKIKT 193

  Fly   382 PSQVDPMDEKGNRPENTAGHIRFEGIRFRYPARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTL 446
            .|.     ...:|..:...|        |.....:.|.:..|.|      |:|.:.:|       
Zfish   194 LSL-----SHSSRWHSDTSH--------REDMLGEAERVAELVV------TLACIWSS------- 232

  Fly   447 IQLMQRFYDPEAGSVKLDGRDLR-TLNVGWLRSQIG---VVGQEPVLFATTIGENIRYGRPSATQ 507
                                .|| ||.:|.|.:::|   :||...:|....:        .||.:
Zfish   233 --------------------PLRVTLYLGLLWAKLGPSVLVGVTLLLVLIPV--------KSAVE 269

  Fly   508 ADIEKAARAANCHDFITRLPKGYDTQVGEKGAQISGGQKQRIAIARALVRQPQVLLLDEATSALD 572
               .||.:....|..|.           ||..|:         |...|.:...:.||...:....
Zfish   270 ---RKAKQLRRTHRVIR-----------EKSEQL---------IKEMLHKYQALKLLTWESWFFQ 311

  Fly   573 PTSEKRVQSALELASQGPTTLVVAHRLSTITNADKIVFLKDG--VVAEQGT-------------- 621
            ..:|.|.:....|..||  .|.....|.:|.....::|...|  |:.:.|.              
Zfish   312 RVTESRTRELEMLRIQG--FLTAFSMLDSICMPFLVIFSSLGAFVLVDDGNVLTSSQIFTSVCFF 374

  Fly   622 ---HEELMERRGLYCELVSITQRKEATEAD---EGAVAGRPLQKSQNLSDEETDDDEEDEEEDEE 680
               ...|:|..||:..|      |:|.::.   |.......|..||.|:...|::...|..:...
Zfish   375 RLLRPPLLEFLGLFSVL------KQAQQSFCYLEKIFLTEDLGTSQFLTKGATEESSADSTQQPC 433

  Fly   681 PELQTSGSSRDSGFRASTRRKRRSQRRKKKKDKEVVSKVSFTQLMKLNSPEWRFIVV-------- 737
            .|.|...:..|         ::|.....:.:.:|..       .:.|.:..|.::.|        
Zfish   434 DECQEKQNDSD---------EKRDHYHFRNEFREAC-------WLYLGAFGWHWVSVCSLVYLSV 482

  Fly   738 -------GGIASVMHGATFPLWGLFFGDFFGILSDGDDDVVRAEVLKISMIFVGIGLMAGLGNML 795
                   .|:..:..|....:.||          ||..::..:.:...::    :||:.......
Zfish   483 CAVSLAQDGVLCMWTGEAKEVQGL----------DGWKELRNSRLSAYAL----LGLLQAFLVCC 533

  Fly   796 QTYMFTTAGVKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDCSNVQGATGARVGTML 860
            ..|..|...:|.:..|.......::...:   ..::.:...|...|..|...:.......:.::|
Zfish   534 AAYCLTCGSLKASRTLHTELLSDVLHLPV---HSQKMNTRKLMQALTQDMQVIDEELPKHLHSIL 595

  Fly   861 QAVATLVVGM-VVGFVFSWQQTLLTLVTLPLVCLSVYLEGRFIMKSAQKAKASIEEASQVAVEAI 924
            :::..::..: ::.|:.    .:.:|...|::.|.::::.|  :.|......::|....|::.::
Zfish   596 KSLLDVLSTITLISFII----PVFSLAVCPMIILLLHIQSR--ISSTHMQIRNMEANPAVSLTSL 654

  Fly   925 TNI-----RTVNG-----LCLERQVLDQYVQQIDRVDIACRRKVRFRGLVFALGQAAPFLAYG-- 977
            ..:     .:::|     :|| :..|..:.|.:                         .|.|.  
Zfish   655 ARVTQCAEASLSGPEHRAVCL-KHCLQAFTQNL-------------------------LLKYNTI 693

  Fly   978 -----ISMYYGGI------LVAEERMNYEDIIKVAEALIFGSWMLGQALAYAPNVNDAI----LS 1027
                 :.:::.|:      ||:...:..:....:....:..|:.:.:||.|.|.....|    ||
Zfish   694 NTESWVVLWFDGVAGIVLLLVSLILLQTQPESGLVALTLICSFNIKEALHYCPQAASVITTDMLS 758

  Fly  1028 AGRLMDLFKRTSTQPNPP-----QSPYNTVEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKS 1087
               |.:||.....:....     :.||:..:  .|::.:.|...| .:..|||.|:|::|||.|.
Zfish   759 ---LQNLFDSAKAEKEAEWTVNYRPPYDWPQ--HGEVKFRNYESE-ASSDGTPALRGVHLTILKG 817

  Fly  1088 TTVALVGPSGSGKSTCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIA 1152
            ..:.:|....:.....:..|.|..:..||::.:..:..:...|..||.:|.::||.||||...:.
Zfish   818 EKIGVVSRQKTDTDVLINSLFRSVEARSGALLIDNINISRMGLHDLRGRLQIISQVPVLFSGPLR 882

  Fly  1153 ENIAYGNNFRDDVSMQEIIEAAKKSNIHNFISALPQGYDTRLGKTS-QLSGGQKQRIAIARALVR 1216
            .|:   :.|.:. |..::..|.:..::...:..:|......:.:|: ..|.||::.:.:||||:.
Zfish   883 ANL---DPFAEH-SDAQVWLALELCHLKESVQQMPAQLLHPVQRTALAFSFGQRRLLCLARALLA 943

  Fly  1217 NPKILILDEATSALDLESEKVVQQALDEARSGRTCLTIAHRLTTVRNADLICVLKRGVVVEHGTH 1281
            ..:||:::|....:|.|:|.::||.:.......|.|.::....:|.:.|.:.||.:|..|:....
Zfish   944 RVRILLVEEPLHHVDPETEDLLQQVIHAEFKDCTVLFLSQNPLSVLHTDRVLVLDKGQAVKFDAP 1008

  Fly  1282 DELMALNKIYA 1292
            ..|:....:::
Zfish  1009 STLLQQGPLFS 1019

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 34..640 CDD:224055 90/476 (19%)
ABC_membrane 116..352 CDD:279056 30/157 (19%)
ABC_MTABC3_MDL1_MDL2 402..636 CDD:213216 47/257 (18%)
MdlB 735..1299 CDD:224055 105/608 (17%)
ABC_membrane 739..998 CDD:279056 34/283 (12%)
ABC_MTABC3_MDL1_MDL2 1059..1298 CDD:213216 56/236 (24%)
abcc13XP_017209479.1 SunT 29..>409 CDD:331423 90/480 (19%)
SunT <461..1018 CDD:331423 107/616 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.