DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mdr49 and Abcc6

Sequence 1:NP_523724.2 Gene:Mdr49 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:XP_006541009.1 Gene:Abcc6 MGIID:1351634 Length:1500 Species:Mus musculus

Alignment Length:1236 Identity:261/1237 (21%)
Similarity:478/1237 (39%) Gaps:232/1237 (19%)


  Fly    44 FLL-VVSLLVATAASAFIPYFMIIYGEFTSLLVDRTVGVGTSSPAFALPMFGGGQQLTNASKEEN 107
            ||| .:||:::.|....:|..:.::.||   :.||.....|.. ..|:.||......|...::..
Mouse   377 FLLGTLSLVISDAFRFAVPKLLSLFLEF---MGDRNSSAWTGW-LLAVLMFAAACLQTLFEQQHM 437

  Fly   108 NQAIIDDATAFGIGSLVGSVAMFLLITLAIDLANRIALNQIDRIRKLFLEAMLRQDIAWYDTSSG 172
            .:|.:                        :.:..|.|:..:...:.|.|.:..|:      :|:.
Mouse   438 YRAKV------------------------LQMRLRTAITGLVYRKVLVLSSGSRK------SSAA 472

  Fly   173 SNFASKMTEDLDKLKEGIGEKIVIVVFL--IMTFVIGIVSAFVYGWKL--------TLVVLSCVP 227
            .:..:.::.|:.:|.|.|       ::|  :....:.|...|||.|:|        ..|.||.:|
Mouse   473 GDVVNLVSVDIQRLAESI-------IYLNGLWLLFLWIFVCFVYLWQLLGPSALTAVAVFLSLLP 530

  Fly   228 FIIAATSVVARLQGSLAEKELKSYSDAANVVEEVFSGIRTV------FAF-------SGQEKEKE 279
            .    ...:.:.:|...|::::..:..|.:...:...:||:      .||       .|||....
Mouse   531 L----NFFITKKRGFHQEEQMRQKASRARLTSSMLRTVRTIKSHGWEHAFLERLLHIRGQELSAL 591

  Fly   280 RFGKLLIPAENTGRKKGLYSGMGNALSWLIIYLCMALAIWYGVTLILDERDLPDRVYTPAVLVIV 344
            :...||...              :.:|:.:....:||.::...||:.::..:...   .|.:.:.
Mouse   592 KTSTLLFSV--------------SLVSFQVSTFLVALVVFAVHTLVAEDNAMDAE---KAFVTLT 639

  Fly   345 LFAVIMGAQNLGFASPHVEAIAVATAAGQTL--FNIIDRPSQVDPMDE-KGNRPENTAGHIRFEG 406
            :.:::..||  .|....|..|..|..:...|  |..::   :|||... ..|...::...|....
Mouse   640 VLSILNKAQ--AFLPFSVHCIVQARVSFDRLAAFLCLE---EVDPNGMIASNSRRSSKDRISVHN 699

  Fly   407 IRFRYPARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDLRTL 471
            ..|.: ::.....|.|:.:.|..|..:|.||..|.|||:|:..:........|||.::|      
Mouse   700 GTFAW-SQESPPCLHGINLTVPQGCLLAVVGPVGAGKSSLLSALLGELLKVEGSVSIEG------ 757

  Fly   472 NVGWLRSQIGVVGQEPVLFATTIGENIRYGRPSATQADIEKAARAANCHDFITRLPKGYDTQVGE 536
                   .:..|.||..:..|::.||:.: |.......::|...|......:...|.|..|.:||
Mouse   758 -------SVAYVPQEAWVQNTSVVENVCF-RQELDLPWLQKVLDACALGSDVASFPAGVHTPIGE 814

  Fly   537 KGAQISGGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELAS---QGPTTLVVAHR 598
            :|..:|||||||:::|||:.::..:.|||:..:|||....::|...:...|   ||.|.::|.|.
Mouse   815 QGMNLSGGQKQRLSLARAVYKKAAIYLLDDPLAALDAHVSQQVFKQVIGPSGLLQGTTRILVTHT 879

  Fly   599 LSTITNADKIVFLKDGVVAEQGTHEELMERRGLYCELVSITQR-----KEATEADEGAVAG---- 654
            |..:..||:|:.|.:|.:||.|::::|::|.|....|:...::     ..||..|.|...|    
Mouse   880 LHVLPQADRILVLANGTIAEMGSYQDLLQRNGALVGLLDGARQPAGTHDAATSDDLGGFPGGGRP 944

  Fly   655 -------RPLQ----KSQNLSDEETDDDEEDEEEDEEPELQTSGSSRDSGFRASTRRKRRSQRRK 708
                   ||.:    |.::.|:.:.:...:|      ||.....:..|     |.|..|      
Mouse   945 TCRPDRPRPTEAAPVKGRSTSEVQMEASLDD------PEATGLTAEED-----SVRYGR------ 992

  Fly   709 KKKDKEVVSKVSFTQLMKLNSPEWRF----IVVGGIASVMHGATFPLWGLFFGDFFGILSDGDDD 769
                  |.:.:..:.|..:.:|...:    .:...:||...|....||             .||.
Mouse   993 ------VKTTIYLSYLRAVGTPLCTYTLFLFLCQQVASFSQGYWLSLW-------------ADDP 1038

  Fly   770 VVRAEVLKISM---IFVGIGLMAGLGNMLQTYMFTTAGVKMTTRLRKRAFGTIIGQDIAYFDDER 831
            ||....:..::   :|..:|.:..:|...........|.:.:..|.:.....:....|.:|  ||
Mouse  1039 VVDGRQMHAALRGWVFGLLGCLQAIGLFASMAAVFLGGARASGLLFRSLLWDVARSPIGFF--ER 1101

  Fly   832 NSVGALCSRLASDCSNVQGATGARVGTMLQAVATLVVGMV-VGFVFSWQQTLLTLVTLPLVCLSV 895
            ..||.|.:|.:.:...|.    ..:...|:::.|...|:: ||...:....|..:..|||:.|..
Mouse  1102 TPVGNLLNRFSKETDTVD----VDIPDKLRSLLTYAFGLLEVGLAVTMATPLAIVAILPLMVLYA 1162

  Fly   896 YLEGRFIMKSAQKAKASIEEASQVA---VEAITNIRTVNGLCLERQVLDQYVQQID---RVD--- 951
            ..:..::..|.|..:......|.|.   .|.......|.....:.....|:...:|   ||.   
Mouse  1163 GFQSLYVATSCQLRRLESARYSSVCSHMAETFQGSLVVRAFRAQASFTAQHDALMDENQRVSFPK 1227

  Fly   952 ------IACRRKVRFRGLVFALGQAAPFLAYGISMYYGGILVAEERMNYEDIIKVAEAL--IFGS 1008
                  :|...::...||||.....|......:|....|..|:.       .::|.:.|  :..|
Mouse  1228 LVADRWLATNLELLGNGLVFVAATCAVLSKAHLSAGLVGFSVSA-------ALQVTQTLQWVVRS 1285

  Fly  1009 WMLGQALAYAPNVNDAILSAGRLMDLFKRTSTQP-NPPQSPYNTVEKSEGDIVYENVGFEYPTRK 1072
            |         .::.:::::..|:.|..:.....| ..|......:....|.|.:.:.|..:  |.
Mouse  1286 W---------TDLENSMVAVERVQDYARIPKEAPWRLPTCAAQPLWPCGGQIEFRDFGLRH--RP 1339

  Fly  1073 GTPI-LQGLNLTIKKSTTVALVGPSGSGKSTCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSK 1136
            ..|: :||::|.|.....|.:||.:|:|||:....|||..:...|::.:.|||.|...|.||||:
Mouse  1340 ELPLAVQGVSLKIHAGEKVGIVGRTGAGKSSLAWGLLRLQEAAEGNIWIDGVPITHVGLHTLRSR 1404

  Fly  1137 LGLVSQEPVLFDRTIAENIAYGNNFRDDVSMQEIIEAAKKSNIHNFISALP---------QGYDT 1192
            :.::.|:||||..::..|:.......|    :.|..|.:...:..|:::||         ||.|.
Mouse  1405 ITIIPQDPVLFPGSLRMNLDLLQEHTD----EGIWAALETVQLKAFVTSLPGQLQYECAGQGDDL 1465

  Fly  1193 R 1193
            |
Mouse  1466 R 1466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 34..640 CDD:224055 137/626 (22%)
ABC_membrane 116..352 CDD:279056 39/259 (15%)
ABC_MTABC3_MDL1_MDL2 402..636 CDD:213216 69/237 (29%)
MdlB 735..1299 CDD:224055 105/492 (21%)
ABC_membrane 739..998 CDD:279056 52/278 (19%)
ABC_MTABC3_MDL1_MDL2 1059..1298 CDD:213216 44/146 (30%)
Abcc6XP_006541009.1 MTABC_N 89..>216 CDD:292803
MRP_assoc_pro 101..1465 CDD:188098 260/1234 (21%)
ABC_membrane 381..645 CDD:294371 53/326 (16%)
ABCC_MRP_domain1 695..896 CDD:213217 62/216 (29%)
ABC_membrane 1014..1279 CDD:294371 53/291 (18%)
P-loop_NTPase 1326..>1465 CDD:304359 44/145 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.