DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mdr49 and mrp-8

Sequence 1:NP_523724.2 Gene:Mdr49 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_499598.2 Gene:mrp-8 WormBaseID:WBGene00003414 Length:1461 Species:Caenorhabditis elegans

Alignment Length:1454 Identity:329/1455 (23%)
Similarity:561/1455 (39%) Gaps:318/1455 (22%)


  Fly    41 CERFLLV-----VSLLVATAASAF----IPYFMIIYGEFTSLLVDRTVGVG----------TSSP 86
            |..||::     |.:||....|.|    ...|:::..| |:||...|..:|          ....
 Worm   118 CLIFLILLVLKAVQVLVLVFESTFDAGVTAEFVLLMAE-TALLASSTKRLGEDEQKIEQTPEEKS 181

  Fly    87 AFALPMF----------GGGQQLTNASKEENNQ------------AIIDDATA---FGIGSLVGS 126
            :|...:|          |..|.|||.|....|:            |..|...|   .|..|:|..
 Worm   182 SFLSKIFFCWLNPLIRAGAKQPLTNESLHNLNENATSEWLYTRWRAEFDKEKAGRKSGETSIVWP 246

  Fly   127 V-----AMFLLITLA------IDLANRIALNQ-IDRI-----------------------RKLF- 155
            .     |..:.:|||      :...|.|.|.| ||.:                       |.|. 
 Worm   247 FIRIQRATIITLTLARLTADIVHYLNPILLKQLIDYVSLHDQPLSFGIAIACIMFSCSTTRSLLQ 311

  Fly   156 ---LEAMLRQDIAWYDT---------------SSGSN-----FASKMTEDLDKLKEGIGE----- 192
               :..|.||.: :|.|               |:.||     ..:....|::.:...:..     
 Worm   312 NYQIAGMCRQAV-YYQTVLSNAILHKILRLSPSARSNRTAGEILNHAAVDIEIIVHSVPYLQNMW 375

  Fly   193 KIVIVVFLIMTFVIGIVSAFVYGWKL---TLVVLSCVPFIIAATSVVARLQGSLAEKELKSYSDA 254
            .:...|.|.||.:     |...||..   ..:::..:|..:..:..:...|    :|::|...:.
 Worm   376 SVPFQVTLAMTML-----AITLGWAAMAGVCIMILFIPLNLCTSRFIKLSQ----QKQMKIKDER 431

  Fly   255 ANVVEEVFSGIRTVFAFSGQEKEKERFGKLLIPAENTGRKKGLYS---GMGNALSWLII----YL 312
            ..:..|:.:||:.|..::.:|..:::..:|........|...:.|   .:.||.|..::    :.
 Worm   432 TKLSNEMLNGIKVVKLYAWEESFEDQINRLRAKEVKMLRNVCILSRIVDVANAASPFLVAIGSFT 496

  Fly   313 CMALAIWYGVTLILDERDLPDRVYTPAVLVIVLFAVIMGAQNLGFASPHVEAIAVATAAGQTLFN 377
            |..|  |..     ||..|     ||:|..:.|.......|.:...:..:..:..|..:.:.|..
 Worm   497 CYVL--WSP-----DENGL-----TPSVAFVALTIFNQLRQPMRMVANLINTLVQARVSNKRLRQ 549

  Fly   378 IIDRPSQVDPMDEKGNRPENTA--GHIRFEGIRFRYPARPDVEILKGLTVDVLPGQTVAFVGASG 440
            .::        ||:..|....|  ..|.|:.....:....:..:||.|:..:.|||.:|.||:.|
 Worm   550 FLN--------DEEMERKTEVALGNAIVFKNASLNWKGPQNPPVLKDLSATIKPGQLIAIVGSVG 606

  Fly   441 CGKSTLIQLMQRFYDPEAGSVKLDGRDLRTLNVGWLRSQIGVVGQEPVLFATTIGENIRYGRPSA 505
            .|||:|:..:   .|.   .|.||||    :.||   ..|..|.|...:|..||.|||.:|...:
 Worm   607 GGKSSLLSAV---LDE---MVLLDGR----VKVG---GSIAYVPQHSWIFNKTIKENILFGNELS 658

  Fly   506 TQADIEKAARAANCHDFITRLPKGYDTQVGEKGAQISGGQKQRIAIARALVRQPQVLLLDEATSA 570
            .....:.........|| ....:|.:|.|||.|..:|||||.||::|||:.:...:.|||:..||
 Worm   659 NYFYDQVVGSCQLKTDF-RHFQQGENTMVGENGITLSGGQKARISLARAVYQDKDIYLLDDPLSA 722

  Fly   571 LDPTSEKRVQSALELASQGP-------TTLVVAHRLSTITNADKIVFLKDGVVAEQGTHEELMER 628
            :|    ..|..||.....||       |.::|.|.|......|.|..::||.:.:.|:.|::...
 Worm   723 VD----AHVGRALFDKVIGPDGLLRSKTRVLVTHNLQYTKYVDTIYVIEDGQIVQHGSFEDIAYV 783

  Fly   629 RGLYCELVSITQRKEATEADEGAVAGRPLQKSQNLSDEETDDDEEDEEEDEEPELQTSGSSRDSG 693
            .|.:                     ||...:.:|..::..|::.|..|....|.:....:..:..
 Worm   784 DGPF---------------------GRLWSECENSDEDVADEEAESSEASVTPPVPVLENGDNGA 827

  Fly   694 FRASTRRKR------RSQRRKKKKDKEVVSKVSFTQLMKLNSPEWR-FIVVGGIAS--------V 743
            ...|::..|      ...|:.::|.::|...|...||.::....:: :|...||.:        :
 Worm   828 IEKSSQIDRTNSHFSEKSRKSEEKPQKVEKNVENVQLGRVKKSVYQLYIKTMGIFNSSAFLIFFI 892

  Fly   744 MHGATFPLWGLFFGDFF--------GILSDGD--------DDVVRAEVLKISMIFVGIGLMAGLG 792
            .|.....:..|:..|:.        ..||..|        |..|..|...|  ::.|.|   ||.
 Worm   893 AHFTVMIMRSLWLSDWSNENAAIKKATLSSVDYLNSTSSVDGPVSVETRLI--VYAGFG---GLE 952

  Fly   793 NMLQTYMFT--TAG-VKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDC-------SN 847
            .:|....||  |.| ::.:..|.......::...|::||  ....|.:.:||:.|.       .|
 Worm   953 MLLLALAFTVLTIGSLRASYGLHSPLIHALLVAPISFFD--TTPTGRIINRLSRDLDVIDKLQDN 1015

  Fly   848 VQGATGARVGTMLQAVATLVVGMVVGFVFSWQQTLLTLVTLPLVCLSVYLEGRFIMKSAQKAK-- 910
            ::..|    .|:|.|...||       :.|....:..:...||:.:..::...:|..|.|..:  
 Worm  1016 IRMCT----QTLLNACMILV-------LISISTPIFLVCAAPLILIYYFVMIYYIPTSRQLKRLE 1069

  Fly   911 ------------ASIEEASQVAVEAITNIRTVNGLC--LERQVLDQYVQQIDRVDIACRRKVRFR 961
                        .||..||.:.....|. ||...|.  :::....:|:..:....:|.|.::   
 Worm  1070 SANRSPILSTIAESIHGASSIRAFDKTE-RTTTALSTNVDKFAQCRYLSHMSNRWLATRLEL--- 1130

  Fly   962 GLVFALGQAAPF---LAYGISMYYGGILVAEERMNYEDIIKVAEALIFGSWMLGQALAYAPNVND 1023
                 ||.....   |:..:|..|.|:......::....:.:.|       :|...:.....:..
 Worm  1131 -----LGNTCVLFASLSATLSTKYFGLTPGMAGLSVSYALTITE-------VLNICVRSVSEIES 1183

  Fly  1024 AILSAGRLMDLFKRTSTQPNPPQSPYNTVEKS---------EGDIVYENVGFEYPTRKGTP-ILQ 1078
            .|:|..|:.:.      |...|::|:. :|||         :|.|  |..||....||..| :|:
 Worm  1184 NIVSVERVNEY------QKLEPEAPWR-IEKSLENEEKWPVKGKI--ELDGFSMRYRKNLPLVLK 1239

  Fly  1079 GLNLTIKKSTTVALVGPSGSGKSTCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQE 1143
            .::|.|:....:.::|.:|||||:....|.|..:..||::.:..|......|..|||||.::.||
 Worm  1240 NIDLKIEGGERIGVIGRTGSGKSSLTMALYRMIEGESGTIKIDDVEIDTIGLHQLRSKLIIIPQE 1304

  Fly  1144 PVLFDRTIAENIAYGNNFRDDVSMQEIIEAAKKSNIHNFISALPQGYDTRLGKTSQ-LSGGQKQR 1207
            ||:|..|:..|:...|.:.||    :|....:...:..|.....:..|..:.:..: :|.|::|.
 Worm  1305 PVVFSGTLRFNLDPFNQYSDD----QIWNCLEICQLKQFAQEDDKTLDRYIAEGGKNMSVGERQL 1365

  Fly  1208 IAIARALVRNPKILILDEATSALDLESEKVVQQALDEARSGRTCLTIAHRLTTVRNADLICVLKR 1272
            :.:.|||:|..:|:||||||:::|..::.:||:|:.:.....|.::|||||.|:.::|.|.||..
 Worm  1366 LCLCRALLRGARIVILDEATASVDTVTDGIVQRAIRQHFPQSTTISIAHRLDTIVDSDRIVVLDA 1430

  Fly  1273 GVVVEHGTHDELMALN--KIYANL 1294
            |.|.|..|...|: ||  .:|:.|
 Worm  1431 GRVAEFDTPSNLL-LNPDSLYSQL 1453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 34..640 CDD:224055 164/726 (23%)
ABC_membrane 116..352 CDD:279056 57/313 (18%)
ABC_MTABC3_MDL1_MDL2 402..636 CDD:213216 74/241 (31%)
MdlB 735..1299 CDD:224055 150/627 (24%)
ABC_membrane 739..998 CDD:279056 59/312 (19%)
ABC_MTABC3_MDL1_MDL2 1059..1298 CDD:213216 78/241 (32%)
mrp-8NP_499598.2 CFTR_protein 173..1459 CDD:273530 314/1399 (22%)
ABC_membrane 259..527 CDD:294371 53/290 (18%)
ABCC_MRP_domain1 568..770 CDD:213217 71/220 (32%)
ABC_membrane 887..1168 CDD:294371 57/308 (19%)
ABCC_MRP_domain2 1219..1439 CDD:213211 74/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.