DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mdr49 and Abcb1a

Sequence 1:NP_523724.2 Gene:Mdr49 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_035206.2 Gene:Abcb1a MGIID:97570 Length:1276 Species:Mus musculus

Alignment Length:1303 Identity:549/1304 (42%)
Similarity:790/1304 (61%) Gaps:100/1304 (8%)


  Fly    30 SYFDLFRYSTRCERFLLVVSLLVATAASAFIPYFMIIYGEFTSLLVDRTVGVGTSSPAFALPMFG 94
            |...:|||:...:|..::|..|.|......:|..|:|:|:.|    |....||            
Mouse    34 SVLTMFRYAGWLDRLYMLVGTLAAIIHGVALPLMMLIFGDMT----DSFASVG------------ 82

  Fly    95 GGQQLTNASKEENNQAIIDDATAF---------------GIGSLVGSVAMFLLITLAIDLANRIA 144
                  |.||...|.:..|....|               |||:.|..|| ::.::.....|.|  
Mouse    83 ------NVSKNSTNMSEADKRAMFAKLEEEMTTYAYYYTGIGAGVLIVA-YIQVSFWCLAAGR-- 138

  Fly   145 LNQIDRIRKLFLEAMLRQDIAWYDTSSGSNFASKMTEDLDKLKEGIGEKIVIVVFLIMTFVIGIV 209
              ||.:||:.|..|::.|:|.|:|........:::|:|:.|:.||||:||.:....:.||..|.:
Mouse   139 --QIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFI 201

  Fly   210 SAFVYGWKLTLVVLSCVPFIIAATSVVARLQGSLAEKELKSYSDAANVVEEVFSGIRTVFAFSGQ 274
            ..|..|||||||:|:..|.:..:..:.|::..|..:|||.:|:.|..|.|||.:.||||.||.||
Mouse   202 IGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQ 266

  Fly   275 EKEKERFGKLLIPAENTGRKKGLYSGMGNALSWLIIYLCMALAIWYGVTLILDERDLPDRVYTPA 339
            :||.||:...|..|:..|.||.:.:.:....::|:||...|||.|||.:|::.:.      |:..
Mouse   267 KKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKE------YSIG 325

  Fly   340 VLVIVLFAVIMGAQNLGFASPHVEAIAVATAAGQTLFNIIDRPSQVDPMDEKGNRPENTAGHIRF 404
            .::.|.|:|::||.::|.|||::||.|.|..|...:|.|||....:|...:.|::|:|..|::.|
Mouse   326 QVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGNLEF 390

  Fly   405 EGIRFRYPARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDLR 469
            :.|.|.||:|.:|:|||||.:.|..|||||.||.|||||||.:|||||.|||..|.|.:||:|:|
Mouse   391 KNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIR 455

  Fly   470 TLNVGWLRSQIGVVGQEPVLFATTIGENIRYGRPSATQADIEKAARAANCHDFITRLPKGYDTQV 534
            |:||.:||..||||.||||||||||.|||||||...|..:||||.:.||.:|||.:||..:||.|
Mouse   456 TINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLV 520

  Fly   535 GEKGAQISGGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHRL 599
            ||:|||:||||||||||||||||.|::|||||||||||..||..||:||:.|.:|.||:|:||||
Mouse   521 GERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRL 585

  Fly   600 STITNADKIVFLKDGVVAEQGTHEELMERRGLYCELVSITQRKEATEADEGAVAGRPLQKSQNLS 664
            ||:.|||.|.....||:.|||.|:|||..:|:|.:|| :||           .||..::    |.
Mouse   586 STVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLV-MTQ-----------TAGNEIE----LG 634

  Fly   665 DEETDDDEEDEEEDEEPELQTSGSSRDSGFRASTRRKRRSQRR---------KKKKDKEV----V 716
            :|.....:|.:..|.        ||:|||   |:..:|||.|:         :|...||.    |
Mouse   635 NEACKSKDEIDNLDM--------SSKDSG---SSLIRRRSTRKSICGPHDQDRKLSTKEALDEDV 688

  Fly   717 SKVSFTQLMKLNSPEWRFIVVGGIASVMHGATFPLWGLFFGDFFGILSD-GDDDVVRAEVLKISM 780
            ...||.:::||||.||.:.|||...::::|...|.:.:.|....|:.:: |..:..|......|:
Mouse   689 PPASFWRILKLNSTEWPYFVVGIFCAIINGGLQPAFSVIFSKVVGVFTNGGPPETQRQNSNLFSL 753

  Fly   781 IFVGIGLMAGLGNMLQTYMFTTAGVKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDC 845
            :|:.:|:::.:...||.:.|..||..:|.|||...|.:::.||:::|||.:|:.|||.:|||:|.
Mouse   754 LFLILGIISFITFFLQGFTFGKAGEILTKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDA 818

  Fly   846 SNVQGATGARVGTMLQAVATLVVGMVVGFVFSWQQTLLTLVTLPLVCLSVYLEGRFIMKSAQKAK 910
            :.|:||||:|:..:.|.:|.|..|:::..::.||.|||.|..:|::.::..:|.:.:...|.|.|
Mouse   819 AQVKGATGSRLAVIFQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDK 883

  Fly   911 ASIEEASQVAVEAITNIRTVNGLCLERQVLDQYVQQIDRVDIACRRKVRFRGLVFALGQAAPFLA 975
            ..:|.:.::|.|||.|.|||..|..|::....|.|.:........:|....|:.|:..||..:.:
Mouse   884 KELEGSGKIATEAIENFRTVVSLTREQKFETMYAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFS 948

  Fly   976 YGISMYYGGILVAEERMNYEDIIKVAEALIFGSWMLGQALAYAPNVNDAILSAGRLMDLFKRTST 1040
            |.....:|..||.::.|.:|:::.|..|::||:..:||..::||:...|.:||..::.:.::|  
Mouse   949 YAACFRFGAYLVTQQLMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKATVSASHIIRIIEKT-- 1011

  Fly  1041 QPNPPQSPYNT----VEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKSTTVALVGPSGSGKS 1101
               |....|:|    ....||::.:..|.|.||||...|:||||:|.:||..|:||||.||.|||
Mouse  1012 ---PEIDSYSTQGLKPNMLEGNVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKS 1073

  Fly  1102 TCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIAENIAYGNNFRDDVS 1166
            |.||||.|:|||::|||.|.|....:..:..||::||:|||||:|||.:||||||||:|.| .||
Mouse  1074 TVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSR-VVS 1137

  Fly  1167 MQEIIEAAKKSNIHNFISALPQGYDTRLG-KTSQLSGGQKQRIAIARALVRNPKILILDEATSAL 1230
            .:||:.|||::|||.||.:||..|:||:| |.:||||||||||||||||||.|.||:||||||||
Mouse  1138 YEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSAL 1202

  Fly  1231 DLESEKVVQQALDEARSGRTCLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALNKIYANLY 1295
            |.|||||||:|||:||.||||:.|||||:|::|||||.|::.|.|.|||||.:|:|...||.::.
Mouse  1203 DTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMV 1267

  Fly  1296 LMQ 1298
            .:|
Mouse  1268 SVQ 1270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 34..640 CDD:224055 273/621 (44%)
ABC_membrane 116..352 CDD:279056 84/251 (33%)
ABC_MTABC3_MDL1_MDL2 402..636 CDD:213216 148/234 (63%)
MdlB 735..1299 CDD:224055 246/571 (43%)
ABC_membrane 739..998 CDD:279056 77/260 (30%)
ABC_MTABC3_MDL1_MDL2 1059..1298 CDD:213216 148/240 (62%)
Abcb1aNP_035206.2 PTZ00265 47..1263 CDD:240339 543/1282 (42%)
ABC_membrane 54..339 CDD:279056 100/318 (31%)
ABC_MTABC3_MDL1_MDL2 389..625 CDD:213216 150/237 (63%)
ABC_membrane 711..982 CDD:279056 81/271 (30%)
ABC_MTABC3_MDL1_MDL2 1031..1270 CDD:213216 148/240 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D186078at2759
OrthoFinder 1 1.000 FOG0000136
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126596
Panther 1 1.100 O PTHR24221
Phylome 1 0.910 0.617 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R932
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.