DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mdr49 and pgp-8

Sequence 1:NP_523724.2 Gene:Mdr49 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_509811.2 Gene:pgp-8 WormBaseID:WBGene00004002 Length:1243 Species:Caenorhabditis elegans

Alignment Length:1293 Identity:432/1294 (33%)
Similarity:688/1294 (53%) Gaps:102/1294 (8%)


  Fly    34 LFRYSTRCERFLLVVSLLVATAASAFIPYFMIIYGEFTSLLVDRTVGVGTSS--PA---FALPMF 93
            :::.:::.|:||.|:.::.|.......|:....:||.:...|..|..|..:|  |:   .|..||
 Worm    28 VWQCTSKWEKFLFVIGVVSAICTGLTQPFMSYTFGEVSQAFVRITAAVNNASLDPSDLEKAYEMF 92

  Fly    94 GGGQQLTNASKEENNQAIIDDATAFGIGSLVGSVAMFLLITLAIDLANRIALNQIDRIRKLFLEA 158
                     ..:.||..|     .||   |||...||... :...|...|..|...|:|..|:..
 Worm    93 ---------HADMNNVVI-----HFG---LVGCAFMFFGF-IQFSLFKYIGDNTTYRLRHKFILR 139

  Fly   159 MLRQDIAWYDTSSGSNFASKMTEDLDKLKEGIGEKIVIVVFLIMTFVIGIVSAFVYGWKLTLVVL 223
            :|::|..::||.|....::.:.::|::.:|...|||..::.....|.||...||...|     .|
 Worm   140 LLKKDAKYFDTISTGYLSTVLNDNLERFREAFNEKIAFIICFSTDFAIGTALAFYTSW-----TL 199

  Fly   224 SCVPFIIAATSVVARLQGSLA-----EKELKSYSDAANVVEEVFSGIRTVFAFSGQEKEKERFGK 283
            :....:.|...|::.|..|.:     ||:...||:|..:..:.....:||.:.:||.:|.|::..
 Worm   200 ASYGSVFAFGIVISGLLNSTSMMKSNEKQSMHYSNAGAIAFQALCSFKTVISLNGQTQELEKYSA 264

  Fly   284 LLIPAENTGRKKGLYSGMGNALSWLIIYLCMAL---AIWYGVTLILDERDLPDRVYTPAVLVIVL 345
            .|...|..|.::..:......||.   :.|.||   .::.|..||.::.       ...|.::.|
 Worm   265 ELKEGEKFGSRRAFFLATSRGLSH---FFCNALNGTILYVGADLIYNKT-------MNTVAIVTL 319

  Fly   346 F-AVIMGAQNLGFASPHVEAIAVATAAGQTLFNIIDRPSQVDPMDEKGNRPENT------AGHIR 403
            | .::..|.:||.|..|:..:..|..:...:|:::   :..|.|.|.....|.|      .|.:.
 Worm   320 FHYMLFSAFSLGEAFLHISYLLNAINSATPIFDVL---TSDDDMIENNQDNEQTDSNKTIQGMLS 381

  Fly   404 FEGIRFRYPARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDL 468
            |..::|.||:||||:||:|::.||..|:.:|.|||||.||||::||:..||:.::|::|:....|
 Worm   382 FNNVKFAYPSRPDVDILRGISFDVKQGECIALVGASGSGKSTIVQLLLHFYNIQSGTIKIGDSHL 446

  Fly   469 RTLNVGWLRSQIGVVGQEPVLFATTIGENIRYGRPSATQADIEKAARAANCHDFITRLPKGYDTQ 533
            ..:|:..||:.||||.||||||.|||.||||:|.|:||.::|.:|.|.||.:||:..:..|..|.
 Worm   447 HDINLKQLRNAIGVVSQEPVLFNTTIEENIRFGNPNATSSEIYEALRKANAYDFVCNIKDGLKTI 511

  Fly   534 VGEKGAQISGGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHR 598
            |||:|||:||||||||||||.||:.|.:|||||||||||..||:.||.||:.||:|.||:::|||
 Worm   512 VGERGAQLSGGQKQRIAIARVLVKNPAILLLDEATSALDSASERAVQLALKKASEGRTTIIIAHR 576

  Fly   599 LSTITNADKIVFLKDGVVAEQGTHEELMERRGLYCELV--SITQRKEATEADEGAVAGRPLQKS- 660
            ||||.:.|||:.:.:|.:||.|:||||:.....|..||  .....:...|...|..|...:||: 
 Worm   577 LSTIRHCDKIMVMSNGKIAEVGSHEELISMDREYSNLVRAQFFDSQSVEEDINGQGAEEVIQKTP 641

  Fly   661 QNLSDEETDDDEEDEEEDEEPELQTSGSSRDSGFRASTRRKRRSQRRKKKKDKEVVSKVSFTQLM 725
            .||:|.|..:           ||....||                      |.|:.|.:  .:::
 Worm   642 PNLNDGEPLE-----------ELLKETSS----------------------DIEIKSNI--WEVL 671

  Fly   726 KLNSPEWRFIVVGGIASVMHGATFPLWG-LFFGDFFGILSDGDDDVVRAEVLKISMIFVGIGLMA 789
            :...|:...:.:..|.|.:.|..||:.. :....:.....||::.:......  :.:|:.:|::.
 Worm   672 RECRPDAFLLSMAVIGSAIQGCNFPILSQIIVQTYKAYAMDGENILTYGHFW--AAMFLVLGVIR 734

  Fly   790 GLGNMLQTYMFTTAGVKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDCSNVQGATGA 854
            .:....|.:.|.....|::||||.::|..::....|::||.::|...|.:||.:|.||::.|..|
 Worm   735 PITLYCQFFFFGKVSEKLSTRLRIKSFQHLLSLPCAFYDDPKHSPTRLVNRLNTDPSNIKAAVDA 799

  Fly   855 RVGTMLQAVATLVVGMVVGFVFSWQQTLLTLVTLPLVCLSVYLEGRFIMKSAQKAKASIEEASQV 919
            |:|::|.::.:..:.:::...:||:.||..::..|::..:.:|..:....|.::...:.|.::::
 Worm   800 RLGSLLMSMVSFSLAILIACYYSWKLTLQVVLFFPVLYYAKFLYKKTTTISIKEDSVAFENSNKI 864

  Fly   920 AVEAITNIRTVNGLCLERQVLDQYVQQIDRVDIACRRKVRFRGLVFALGQAAPFLAYGISMYYGG 984
            |:|.:.|::||..|.:|.:|::..::.:..:..:..|:....||..........:.|.||..:|.
 Worm   865 AIEVLDNMKTVKALNMEARVINLVMEYLAVLKTSYPRRSVVMGLANGFSAGCSQIVYAISFKFGT 929

  Fly   985 ILVAEERMNYEDIIKVAEALIFGSWMLGQALAYAPNVNDAILSAGRLMDLFKRTSTQPNPPQSPY 1049
            .|:.::.:...|:......|.:.|.|.|.|::|.|:...||.|||.:.:||...:|.|....:..
 Worm   930 YLILQKEVIPMDMYLSLITLSYTSNMAGSAISYMPDFRKAIHSAGLIFNLFTYPATMPFNSDTGS 994

  Fly  1050 NTVEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKSTTVALVGPSGSGKSTCVQLLLRYYDPV 1114
            .::.|  |::..|||.|.|..|....:|..:||.::...|:|:||||||||||.:.||..:|...
 Worm   995 RSITK--GEVNGENVKFHYHQRPDYTVLDSVNLKVEAGKTLAIVGPSGSGKSTIISLLEMFYRAD 1057

  Fly  1115 SGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIAENIAYGNNFRDDVSMQEIIEAAKKSNI 1179
            .|.:.:.........||.|||.||||||.||||:.:|.:||.||  ...::|..||..|.:.:|.
 Worm  1058 QGFIKIDNDNVENINLDHLRSNLGLVSQGPVLFNCSIRDNILYG--LTRNISQTEIENALQIANA 1120

  Fly  1180 HNFISALPQGYDTRLG-KTSQLSGGQKQRIAIARALVRNPKILILDEATSALDLESEKVVQQALD 1243
            .||:..||||.||.:| :.:||||||||||||.||::||||:|:|||||||||.||||:||.|||
 Worm  1121 FNFVFQLPQGLDTIVGDRGAQLSGGQKQRIAITRAILRNPKLLLLDEATSALDTESEKIVQNALD 1185

  Fly  1244 EARSGRTCLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALNKIYANLYLMQQVS 1301
            .|....:.:.:||||:|:.|||.|.||:.|.|||.|||::|:|:...|..|...|:.|
 Worm  1186 TASERLSTIVVAHRLSTIINADSIAVLRNGKVVEQGTHNQLLAVKGDYWRLVQHQKSS 1243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 34..640 CDD:224055 219/628 (35%)
ABC_membrane 116..352 CDD:279056 59/245 (24%)
ABC_MTABC3_MDL1_MDL2 402..636 CDD:213216 127/234 (54%)
MdlB 735..1299 CDD:224055 195/566 (34%)
ABC_membrane 739..998 CDD:279056 57/260 (22%)
ABC_MTABC3_MDL1_MDL2 1059..1298 CDD:213216 119/240 (50%)
pgp-8NP_509811.2 PTZ00265 29..1241 CDD:240339 431/1289 (33%)
ABC_membrane 44..326 CDD:294371 74/315 (23%)
ABC_MTABC3_MDL1_MDL2 382..617 CDD:213216 128/235 (54%)
ABC_membrane 685..953 CDD:279056 58/270 (21%)
ABC_MTABC3_MDL1_MDL2 1005..1240 CDD:213216 119/237 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216582at33208
OrthoFinder 1 1.000 FOG0000136
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126596
Panther 1 1.100 O PTHR24221
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.870

Return to query results.
Submit another query.