DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mdr49 and mrp-2

Sequence 1:NP_523724.2 Gene:Mdr49 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_508121.1 Gene:mrp-2 WormBaseID:WBGene00003408 Length:1525 Species:Caenorhabditis elegans

Alignment Length:1283 Identity:306/1284 (24%)
Similarity:552/1284 (43%) Gaps:249/1284 (19%)


  Fly   118 FGIGSLVGSVAMFLLITLAIDLANRIALNQIDRIRKLFLEAMLRQDIAWYDTSSGSNFASKMTED 182
            |.:|..|.||....:.:.|::|:|               ||...:.|        ....:.|:.|
 Worm   362 FRLGMHVRSVLTSAVYSKALNLSN---------------EARKGKTI--------GAIVNLMSVD 403

  Fly   183 LDKLKEGIGEKIVIVVFLIMTFVIGIVSAFVYGWK-LTLVVLSCVPFIIAATSV---VARLQGSL 243
            :.|:::     :...:.|..:..:.|..:..:.|| |.:..|:.:..:|.|..|   :|......
 Worm   404 IQKIQD-----MAPTIMLFWSAPLQIFLSIYFLWKFLGVAALAGLVVLILALPVNGLIAIQMRKC 463

  Fly   244 AEKELKSYSDAANVVEEVFSGIRTVFAFSGQE-------KEKERFGKLLIPAENTGRKKGLYSGM 301
            ..:::|...:...::.|:.:|::.:..:|.:.       |.:||...:|        ||..|...
 Worm   464 QTEQMKLKDERIKMMSEILNGMKVLKLYSWERSMENMVLKIRERELHIL--------KKLSYFMA 520

  Fly   302 GNALSWLIIYLC---MALAIWYGVTLILDERDLPDRVYTPAVLVIVL------------FAVIMG 351
            ....||    :|   :|..|.:.|.:.||..   :.|.||.:..:.|            .|::.|
 Worm   521 AIVFSW----ICAPFLASVISFVVYVYLDPE---NNVLTPEITFVALSLFDILRMPLAMVAMVYG 578

  Fly   352 AQNLGFASPHVEAIAVATAAGQTLFNIIDRPSQVDPMDEKGNRPENTAGHIRFEGIRFRYPARPD 416
            .             ||..:...|.........::.|.....:...::|  |..|...|.:.:..|
 Worm   579 E-------------AVQCSVSNTRLKEFFAAEEMSPQTSISHGETDSA--IEVENGLFSWSSDED 628

  Fly   417 VEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDLRTLNVGWLRSQIG 481
             ..|:.::..:..||.||.||..|.|||:|:..:....:..:|||:::|             .|.
 Worm   629 -PTLREISFKIQKGQLVAIVGKVGSGKSSLLHALLGEMNKLSGSVQING-------------NIA 679

  Fly   482 VVGQEPVLFATTIGENIRYGRPSATQ--ADIEKAARAANC--HDFITRLPKGYDTQVGEKGAQIS 542
            .|.|:..:...::..||.:.:|...:  .|:.|     ||  .:.:..||.|..|::||||..:|
 Worm   680 YVPQQAWIQNMSLRNNILFNKPYDLENYEDVVK-----NCALKEDLANLPAGDRTEIGEKGINLS 739

  Fly   543 GGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQG----PTTLVVAHRLSTIT 603
            ||||||:::|||:.:.|.::|||:..||:|....|.:...:..:|.|    .|.::|.|.|:.:.
 Worm   740 GGQKQRVSLARAVYQNPDIILLDDPLSAVDSHVGKHIFENVISSSTGCLASKTRVLVTHGLTYLK 804

  Fly   604 NADKIVFLKDGVVAEQGTHEELMERRGLYCELV-------SITQRKEAT------EADE-----G 650
            :.|:::.||:|.::|.||::||:...|.:.|.:       |.|:.:.|:      |.||     |
 Worm   805 HCDQLIVLKEGTISELGTYQELLNNSGAFAEFLEEFLIEESKTRGRVASIGDGSGEVDEILRDLG 869

  Fly   651 AVAGRPLQKSQNLSDEETDDDEEDEEEDEEPELQTSGSSRDSGFRASTRRKRRSQRRKKK----K 711
            .|....|::.::...:|:|.::......|        .||||..|:......|||..:.:    .
 Worm   870 QVKPGILKRLESHLSQESDKEDTSARAIE--------YSRDSSRRSVLLHSPRSQHEENEALLGA 926

  Fly   712 DKEVVSKVSFTQLMKLNSPEWRFIVVGGIASVMHGATFPLWGLFFGDFFGILSDGDDDVVRAEVL 776
            ..|.|.....|||::..:.|...:......:.....:.|:..|||  |..:.|.|...:....:.
 Worm   927 ISEDVPAQENTQLIEKETVETGKVKFEVYIAYFQAISIPITLLFF--FLYVGSSGLGILSNFYLA 989

  Fly   777 KIS-------------MIFVGIGLMAGLGN---MLQTYMFTTAGVKMTTR-LRKRAFGTIIGQDI 824
            |:|             .:.:||..:.|:|.   :|...:..|.||...:| |.....|.|:...:
 Worm   990 KLSDHAKSGNRTSSDAKMELGIYAVLGMGQSFVVLIASIILTIGVLRASRILHAGLLGNIMRSPM 1054

  Fly   825 AYFDDERNSVGALCSRLASDCSNVQGATGARVG----TMLQAVATLVVGMVVGFVFSWQQTLLTL 885
            |:||  ...:|.:.:|:..|...:.......:.    |:...||||||.|       | .|....
 Worm  1055 AFFD--VTPIGRILNRIGKDIEAIDRTLPDVIRHMSMTIFNVVATLVVIM-------W-ATPWAG 1109

  Fly   886 VTLPLVCLSVYLEGRFIMKSAQKAKASIEEAS--------QVAVEAITNIRTVNGLCLERQVLDQ 942
            :...::.:..::..||.:.::::.| .:|.||        |.:::..::||...       |:|.
 Worm  1110 IAFAILSVIYFIVLRFYISTSRQLK-RLESASRSPIYSHFQESIQGASSIRAFG-------VVDN 1166

  Fly   943 YVQQI-DRVD---------IACRRKVRFRGLVFALGQAAPFLAYGISMYYGGILVAEERMNYEDI 997
            :::|. .|||         |...|.:..|  :..:|......|.|.::|:               
 Worm  1167 FIKQSQQRVDDHLIAYYPSIVANRWLAVR--LEMVGNLIVLSAAGAAVYF--------------- 1214

  Fly   998 IKVAEALIFGSWMLGQALAYAPNVNDAILSAGRL----------MDLFKRTSTQPNPPQSPYNTV 1052
             :.:..|..|  ::|.:::||.|:...:..|.|:          ::..|..:..|....:.....
 Worm  1215 -RDSPGLSAG--LVGLSVSYALNITQTLNWAVRMTSELETNIVSVERIKEYTVTPTEGNNSRRLA 1276

  Fly  1053 EKS---EGDIVYENVGFEYPTRKGTP-ILQGLNLTIKKSTTVALVGPSGSGKSTCVQLLLRYYDP 1113
            .||   :|:|..:|....|  |.|.. :|.|::..|..|..|.:||.:|:|||:....|.|..:.
 Worm  1277 AKSWPEKGEISIKNFSVRY--RPGLDLVLHGISAHIAPSEKVGIVGRTGAGKSSLTLALFRIIEA 1339

  Fly  1114 VSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIAENI----AYGNNFRDDVSMQEIIEAA 1174
            ..||:.:.|:......|:.|||.|.:|.|:||||..|:..|:    ||.::        ::.||.
 Worm  1340 DGGSIEIDGINIANLQLEQLRSCLTIVPQDPVLFSGTMKMNLDPFSAYSDS--------QVWEAL 1396

  Fly  1175 KKSNIHNFISALPQGYDTRLGKTSQ-LSGGQKQRIAIARALVRNPKILILDEATSALDLESEKVV 1238
            :.:::..|:.:|..|.:.::.:..: ||.||:|.|.:||||:|..|:|:||||.:|:|:|::.::
 Worm  1397 ENAHLKPFVKSLQDGLEHKISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLI 1461

  Fly  1239 QQALDEARSGRTCLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMA 1286
            |:.:.|.....|.|||||||.||.::|.:.||.:|.|.|..:...|:|
 Worm  1462 QKTIREQFKECTVLTIAHRLNTVMDSDRLLVLDKGRVAEFDSPKNLLA 1509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 34..640 CDD:224055 129/563 (23%)
ABC_membrane 116..352 CDD:279056 49/260 (19%)
ABC_MTABC3_MDL1_MDL2 402..636 CDD:213216 73/242 (30%)
MdlB 735..1299 CDD:224055 153/611 (25%)
ABC_membrane 739..998 CDD:279056 59/298 (20%)
ABC_MTABC3_MDL1_MDL2 1059..1298 CDD:213216 81/235 (34%)
mrp-2NP_508121.1 MRP_assoc_pro 25..1522 CDD:188098 306/1284 (24%)
ABC_membrane 309..570 CDD:294371 47/251 (19%)
ABCC_MRP_domain1 614..816 CDD:213217 66/221 (30%)
ABC_membrane 971..1239 CDD:279056 62/308 (20%)
ABCC_MRP_domain2 1284..1504 CDD:213211 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.