DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sans and AT1G70180

Sequence 1:NP_610829.1 Gene:Sans FlyBaseID:FBgn0033785 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_177175.2 Gene:AT1G70180 AraportID:AT1G70180 Length:460 Species:Arabidopsis thaliana

Alignment Length:498 Identity:101/499 (20%)
Similarity:166/499 (33%) Gaps:153/499 (31%)


  Fly    90 VNIYALDID----------KHSAKDL------AAINGRDEILRYLDVAFTNFEATEKKKSK-ALK 137
            ||..|.|||          |.|.|:.      :::.|.:|::........:|...:.:.|: .|:
plant    21 VNRAASDIDDGYELPRVGTKRSVKERLGNPLDSSVYGGEEVVSKRQRGEASFSGNDLQISRNDLR 85

  Fly   138 -ELAEKNCEKR----------VREYMKRQNQQQQRQD--PEYSD-LSAPSGSSKTGN-----MLS 183
             :|.:||.::|          :||.:.|..|..:..|  |..:: ...|..||:|..     :.|
plant    86 FKLMQKNAQRRAQSDEGCTMDLREKLSRSEQPPRSLDTRPRMAEPRDRPLSSSRTARGSSQMISS 150

  Fly   184 TLKQKIWSSQGNLNKTP-------RDTPPPTKFSDLVGNGSSSSGGSTIASRAGTVQKRPSQLQK 241
            :.....|:.:....::|       |...||......:|.....|.........|:.:.|......
plant   151 SSSHPAWALEDLRRRSPERFVDTSRGRSPPRNAGSFIGIPREPSPPRNGRRMIGSARDRSPPRSD 215

  Fly   242 QHSSTCPHSKISSDTDGGFKV---REVEPDGKRTITSLTGLQRDSEVLYVGTFSSNEDSVGKRGK 303
            ......|.. ||...|.|.:.   |:..|  .|....:||..||         .|...:.|:|  
plant   216 GRIIGSPRD-ISPPRDAGRRFGPPRDQSP--PRNAGRVTGSPRD---------RSPPRNAGRR-- 266

  Fly   304 ISDVFECMEADELDHSDNRSGYSSTLARSFSQPDILGDGQLTQELSEEVTLQRPVGLFDRPTMLG 368
                    .....|.|..||      .||||..            |..::..|.:|.:    |..
plant   267 --------MGPPRDQSPPRS------TRSFSSN------------SRALSPARNMGSY----MSS 301

  Fly   369 SIAFRRSVTAALSQLQLHTDTSSTSTMRNAGSNPPKT--RNGGGKGRLYLN-----------LSD 420
            |..|             ....:..|.|.::..:||::  .:..|:.|:..|           |:.
plant   302 SQGF-------------SPPRNPRSYMGSSRGSPPRSNIEDFHGRSRMLDNMRASPYPVRGVLNG 353

  Fly   421 DTDSEG-------------GGHDI-----------------YSDDDDDDRDAGGSALQRFLAVWA 455
            ...|.|             ..|.:                 :|.|:....|.       ||....
plant   354 QAPSSGAPFARPMLPPPVPNPHPLPPLSQLPPLGSIMQNSPFSVDEPLSVDG-------FLNSIG 411

  Fly   456 LEEYLPVFQKQEIDLETLMLLTESDLKSLGLPLGPFRKLTFAI 498
            |.:|...|:::|:|:.|:..:.|||||.|.:|:||.:|:..||
plant   412 LGKYSLAFKREEVDMTTIKQMKESDLKDLIIPMGPRKKILQAI 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SansNP_610829.1 ANK 6..118 CDD:238125 11/44 (25%)
Ank_2 6..96 CDD:289560 3/6 (50%)
ANK repeat 35..63 CDD:293786
ANK repeat 65..96 CDD:293786 3/6 (50%)
Ank_2 70..149 CDD:289560 18/87 (21%)
SAM_USH1G_HARP 443..508 CDD:188916 20/57 (35%)
SAM 447..503 CDD:197735 20/53 (38%)
AT1G70180NP_177175.2 SAM_1 402..457 CDD:278937 21/61 (34%)
SAM 402..457 CDD:197735 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124803
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.