DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sans and Anks4b

Sequence 1:NP_610829.1 Gene:Sans FlyBaseID:FBgn0033785 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_082361.2 Gene:Anks4b MGIID:1919324 Length:423 Species:Mus musculus

Alignment Length:537 Identity:156/538 (29%)
Similarity:234/538 (43%) Gaps:138/538 (26%)


  Fly     3 SDRFHKAAKDGLLDVLAAATRKDTNAKDSDSMTPVMWAAFEGRLDALRLLCGRGGDPDKCDQFGN 67
            |.|:|:||.|..|::|..||::|.|..|.|.|||.:.||:.|.|:||.::|.|||||||||.:||
Mouse     2 STRYHQAASDSYLELLKEATKRDLNLSDEDGMTPTLLAAYHGNLEALEIICSRGGDPDKCDIWGN 66

  Fly    68 TALHLASAKGHLHCVDFLVKFGVNIYALDIDKHSAKDLAAINGRDEILRYLDVAFTNFEATEKKK 132
            |.||.|::.||.||:.|||.||.||:|||.|..|..|.||...:.|.:..||.|.|.......|:
Mouse    67 TPLHYAASNGHTHCISFLVNFGANIFALDNDLKSPLDAAASREQKECVALLDKAATVQNTMNPKR 131

  Fly   133 SKALKELAEKNCEKRVREYMKRQNQQQQRQDPEYSDLSAPSGSSKTGNMLSTLKQKIWSSQGNLN 197
            ...|||.|.||..|:::|..:.|.:.|.:....||  ...||:..:.:  |||.:...|      
Mouse   132 VTRLKEQALKNARKQMKECERLQERHQNKMARTYS--KEDSGTISSSH--STLSRSFLS------ 186

  Fly   198 KTPRDTPPPTKFSDLVGNGSSSSGGSTIASRAGTVQKRPSQLQKQHSSTCPHSKISSDTDGGFKV 262
                                     :|.|.|.|::.|......|      ..||.:.||     .
Mouse   187 -------------------------TTSAGRFGSLSKGIKDTFK------IKSKKNKDT-----T 215

  Fly   263 REVEPDGKRTITSLTGLQRDSEVLYVGTFSSNEDSVGKRGKISDVFECMEADELDHSD--NRSGY 325
            .::|.||:.....:..:.|:.|          |||..|..|....|...|.|::.|..  ||.|.
Mouse   216 EQLEKDGRSGQRPVMEVFREEE----------EDSFPKDFKEKLHFSVEEDDDVQHESILNRPGL 270

  Fly   326 SSTLARSFSQPDILGDGQLTQELSEEVTLQRPVGLFDRPTMLGSIAFRRSVTAALSQLQLHTDTS 390
            .|.:   ||:..:| |.:...:...|:..:.|..||.|....|::                    
Mouse   271 GSIV---FSRNRVL-DFEDISDSKRELGFKMPSELFQRQGAAGTV-------------------- 311

  Fly   391 STSTMRNAGSNPPKTRNGGGKGRLYLNLSDDTDSEGGGHDIYSDDDDDDRDAGGSA--------- 446
                                        .::.:.|       .:::::.|:|.|:|         
Mouse   312 ----------------------------EEEEEEE-------EEEEEEKREANGTAGDLPWDEEE 341

  Fly   447 ------------LQRFLAVWALEEYLPVFQKQEIDLETLMLLTESDLKSLGLPLGPFRKLTFAIQ 499
                        |:.||....|||:||:|.:::||||.|:|.::.||:::.:.|||.:|:..||.
Mouse   342 VEWEEDAVDATPLEVFLQSQHLEEFLPIFMREQIDLEALLLCSDEDLQNIHMQLGPRKKVLSAID 406

  Fly   500 ERRNALANPGPLVDSRL 516
            :|:..|..||.|||:.|
Mouse   407 KRKQVLQQPGQLVDTSL 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SansNP_610829.1 ANK 6..118 CDD:238125 57/112 (51%)
Ank_2 6..96 CDD:289560 50/90 (56%)
ANK repeat 35..63 CDD:293786 17/28 (61%)
ANK repeat 65..96 CDD:293786 19/31 (61%)
Ank_2 70..149 CDD:289560 35/79 (44%)
SAM_USH1G_HARP 443..508 CDD:188916 27/86 (31%)
SAM 447..503 CDD:197735 24/56 (43%)
Anks4bNP_082361.2 Mediates localization to microvilli. {ECO:0000250|UniProtKB:Q8N8V4} 1..251 102/305 (33%)
ANK 3..117 CDD:238125 58/114 (51%)
ANK repeat 3..29 CDD:293786 11/26 (42%)
Ank_2 6..95 CDD:289560 50/89 (56%)
ANK repeat 31..62 CDD:293786 19/31 (61%)
ANK repeat 64..95 CDD:293786 19/31 (61%)
ANK repeat 97..124 CDD:293786 10/27 (37%)
Mediates interaction with MYO7B. {ECO:0000269|PubMed:26812017} 253..352 22/158 (14%)
SAM_HARP 350..416 CDD:188986 26/66 (39%)
SAM 357..410 CDD:197735 23/53 (43%)
PDZ-binding, mediates interaction with USH1C. {ECO:0000269|PubMed:15461667} 421..423 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5747747
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 238 1.000 Inparanoid score I3335
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T615984
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24161
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5090
TreeFam 1 0.960
98.990

Return to query results.
Submit another query.