DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sans and ush1gb

Sequence 1:NP_610829.1 Gene:Sans FlyBaseID:FBgn0033785 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_685232.6 Gene:ush1gb ZFINID:ZDB-GENE-110411-55 Length:488 Species:Danio rerio

Alignment Length:539 Identity:184/540 (34%)
Similarity:269/540 (50%) Gaps:79/540 (15%)


  Fly     4 DRFHKAAKDGLLDVLAAATRKDTNAKDSDSMTPVMWAAFEGRLDALRLLCGRGGDPDKCDQFGNT 68
            ||||:||:||.|.:|..||||..||.|.|.|||.:|||..|.:|||||:.||||||||||.:|||
Zfish     3 DRFHRAARDGHLLLLKEATRKHLNAPDEDGMTPTLWAAQHGNVDALRLIVGRGGDPDKCDIWGNT 67

  Fly    69 ALHLASAKGHLHCVDFLVKFGVNIYALDIDKHSAKDLAAINGRDEILRYLD-VAFTNFEATEKKK 132
            .||||:|.|||.|:.|||.||.|::.||.|.|:..|:||.....:.:|||| :|........|..
Zfish    68 PLHLAAANGHLSCLSFLVSFGANVWCLDNDYHTPLDMAASRSHMDCVRYLDSIAAKQITINPKLV 132

  Fly   133 SKALKELAEKNCEKRVREYMKRQNQQQQRQDPEYSDLSAPSGSSKT---GNMLSTLKQKIWSSQG 194
            || |||...:|.|||:|...|.|.:..||.:..:...||...:|.|   .:..|||.:::     
Zfish   133 SK-LKERGFRNAEKRIRNCEKLQRKHHQRMERHFMRESAALDTSDTMSYSSFSSTLSRRM----- 191

  Fly   195 NLNKTPRDTPPPTKFSDLVGNGSSSSGGSTIASRAGTVQKRPSQLQKQHSSTCPHSKISSDTDGG 259
                        .:|:.|   .|.:...:|:.|.|....|...:|:|:           ...:|.
Zfish   192 ------------PQFNTL---DSMTYSQATLQSTARGRTKIQRKLEKK-----------KQVEGT 230

  Fly   260 FKVREVEPDGKRTITSLTGLQRDSEVLYV--GTFSSNEDSVGKRGKISDVFECMEADELDHSDNR 322
            ||:.|   ||::::.||:|||..::|:::  |||.........|..|.::|.......|:..|:.
Zfish   231 FKISE---DGRKSVRSLSGLQLGNDVMFLKQGTFVDRRHQSSPRLNIRNMFSGKSDIRLEDVDDE 292

  Fly   323 SGYSSTLARSFSQPDILGDGQLTQELSEEVTLQRPVGLFDRPTMLGSIAFRRSVTAALSQLQLHT 387
               ..|::|:.|.|     |......||..|......||:||. ||::.|||:..   :.....|
Zfish   293 ---EDTVSRALSDP-----GLYEAAYSEISTDSGRDSLFNRPG-LGTMVFRRNYA---TDGVFRT 345

  Fly   388 DTSSTSTMRNAGSNP-PKTRNGGGKGRLYL-------------------NLSDDTDSEGGGHDIY 432
            .....|.   |||.| .:..|...:|||.|                   ||.|....||   |:.
Zfish   346 GRGEGSV---AGSEPVGRAPNIHLRGRLPLRSPSLDEVSIGSSLSLQEKNLQDLPWEEG---DLG 404

  Fly   433 SDDDDDDRDAGGSALQRFLAVWALEEYLPVFQKQEIDLETLMLLTESDLKSLGLPLGPFRKLTFA 497
            .:::||:.....:.|:.|||...|.:|:.:||::::|||.|:|.:|.||.|:.:||||.:||..|
Zfish   405 LEEEDDELQPSSAPLEVFLASQGLSDYVSIFQREQMDLEALLLCSEQDLISIHIPLGPRKKLLDA 469

  Fly   498 IQERRNALANPGPLVDSRL 516
            .:.|.:.:.....::|:.|
Zfish   470 CRRRNSVMEEAEGMLDTTL 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SansNP_610829.1 ANK 6..118 CDD:238125 65/112 (58%)
Ank_2 6..96 CDD:289560 57/90 (63%)
ANK repeat 35..63 CDD:293786 20/28 (71%)
ANK repeat 65..96 CDD:293786 19/31 (61%)
Ank_2 70..149 CDD:289560 37/80 (46%)
SAM_USH1G_HARP 443..508 CDD:188916 25/65 (38%)
SAM 447..503 CDD:197735 25/56 (45%)
ush1gbXP_685232.6 ANK 5..117 CDD:238125 65/112 (58%)
ANK repeat 31..62 CDD:293786 22/31 (71%)
ANK repeat 64..95 CDD:293786 19/31 (61%)
SAM_superfamily 416..479 CDD:326639 25/63 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5747427
eggNOG 1 0.900 E33208_3BEMZ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1344159at2759
OrthoFinder 1 1.000 FOG0005514
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_135035
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.620

Return to query results.
Submit another query.