DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sans and Hip14

Sequence 1:NP_610829.1 Gene:Sans FlyBaseID:FBgn0033785 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001261910.1 Gene:Hip14 FlyBaseID:FBgn0259824 Length:655 Species:Drosophila melanogaster

Alignment Length:121 Identity:33/122 (27%)
Similarity:52/122 (43%) Gaps:1/122 (1%)


  Fly    25 DTNAKDSDSMTPVMWAAFEGRLDALRLLCGRGGDPDKC-DQFGNTALHLASAKGHLHCVDFLVKF 88
            |.|..||:::|.:.|||...|.|.:|....:|...|.. .:...|.||.|:.:|||..|..|:..
  Fly    70 DVNQPDSETVTLLHWAAINNRRDIIRYFLEKGATVDAVGGELNATPLHWATRQGHLGAVVLLMAA 134

  Fly    89 GVNIYALDIDKHSAKDLAAINGRDEILRYLDVAFTNFEATEKKKSKALKELAEKNC 144
            |.:....|.:..|...:||......::.|......:.:..::....||...|.|.|
  Fly   135 GADPRIRDAEGCSCIHIAAQFAHTALVAYFIAKGVDPDLQDRGGMTALMWAAWKVC 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SansNP_610829.1 ANK 6..118 CDD:238125 28/94 (30%)
Ank_2 6..96 CDD:289560 23/72 (32%)
ANK repeat 35..63 CDD:293786 9/29 (31%)
ANK repeat 65..96 CDD:293786 10/31 (32%)
Ank_2 70..149 CDD:289560 19/76 (25%)
SAM_USH1G_HARP 443..508 CDD:188916
SAM 447..503 CDD:197735
Hip14NP_001261910.1 ANK 52..165 CDD:238125 28/95 (29%)
Ank_2 52..142 CDD:289560 23/72 (32%)
ANK repeat 77..108 CDD:293786 9/31 (29%)
ANK repeat 110..142 CDD:293786 10/32 (31%)
ANK 114..233 CDD:238125 20/78 (26%)
Ank_2 116..209 CDD:289560 19/76 (25%)
ANK repeat 144..175 CDD:293786 4/31 (13%)
ANK repeat 177..209 CDD:293786 5/15 (33%)
Ank_5 198..251 CDD:290568
ANK repeat 212..244 CDD:293786
zf-DHHC 426..559 CDD:279823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24161
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.