DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sans and pyx

Sequence 1:NP_610829.1 Gene:Sans FlyBaseID:FBgn0033785 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_612015.1 Gene:pyx FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster

Alignment Length:203 Identity:44/204 (22%)
Similarity:81/204 (40%) Gaps:30/204 (15%)


  Fly     7 HKAAKDGLLDV--LAAATRKDTNAKDSDSMTPVMWAAFEGRLDALRLLCGRGGDPDKCDQFGNTA 69
            |.||::..::.  |....|.:.:.:::...||:..|.....:..:.||...|.:.:...:.|.||
  Fly   271 HLAAENDYVECARLLLEHRAEVDCRNASHQTPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTA 335

  Fly    70 LHLASAK--GHLHCVDFLVKFGVNIYALDIDKHSAKDLAAINGRDEILRYLDVAFTNFE------ 126
            ||.|..|  ..|.|.:.|:|.|.::...|...::...:||:|      .:....:|..|      
  Fly   336 LHAAIVKQSRSLDCCNALLKAGADVNKADNYGYTPLHIAALN------EFSSCVYTFIEHGADIT 394

  Fly   127 ATEKKKSKALKELAEKNCEKRVREYMKRQNQQQQRQDPEYSD----------LSAPSGSSKTGN- 180
            |....:..||..:..:..| .:.:.|::.:...:..|.|..|          |..||.|...|. 
  Fly   395 ARTDGRVSALSFIVRRTPE-IIPKLMQKLDSSIKANDQEIGDVDCQIKLDFRLLVPSSSMDRGET 458

  Fly   181 --MLSTLK 186
              :||.::
  Fly   459 ELLLSLIE 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SansNP_610829.1 ANK 6..118 CDD:238125 27/115 (23%)
Ank_2 6..96 CDD:289560 23/93 (25%)
ANK repeat 35..63 CDD:293786 6/28 (21%)
ANK repeat 65..96 CDD:293786 12/33 (36%)
Ank_2 70..149 CDD:289560 19/87 (22%)
SAM_USH1G_HARP 443..508 CDD:188916
SAM 447..503 CDD:197735
pyxNP_612015.1 Ank_4 99..153 CDD:290365
ANK repeat 102..130 CDD:293786
ANK 127..252 CDD:238125
ANK repeat 132..163 CDD:293786
Ank_2 137..226 CDD:289560
ANK repeat 166..196 CDD:293786
ANK 198..319 CDD:238125 10/48 (21%)
ANK repeat 200..229 CDD:293786
Ank_2 203..296 CDD:289560 5/25 (20%)
ANK repeat 231..262 CDD:293786
ANK 268..387 CDD:238125 28/122 (23%)
ANK repeat 268..296 CDD:293786 5/25 (20%)
Ank_2 270..364 CDD:289560 23/93 (25%)
ANK repeat 298..329 CDD:293786 6/31 (19%)
ANK repeat 331..364 CDD:293786 12/33 (36%)
Ank_5 353..404 CDD:290568 11/57 (19%)
ANK repeat 366..396 CDD:293786 6/36 (17%)
Ion_trans 556..734 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24161
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.