DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sans and ANKS4B

Sequence 1:NP_610829.1 Gene:Sans FlyBaseID:FBgn0033785 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_665872.2 Gene:ANKS4B HGNCID:26795 Length:417 Species:Homo sapiens

Alignment Length:526 Identity:162/527 (31%)
Similarity:238/527 (45%) Gaps:122/527 (23%)


  Fly     3 SDRFHKAAKDGLLDVLAAATRKDTNAKDSDSMTPVMWAAFEGRLDALRLLCGRGGDPDKCDQFGN 67
            |.|:|:||.|..|::|..||::|.|..|.|.|||.:.||:.|.|:||.::|.||||||:||.:||
Human     2 STRYHQAASDSYLELLKEATKRDLNLSDEDGMTPTLLAAYHGNLEALEIICSRGGDPDRCDIWGN 66

  Fly    68 TALHLASAKGHLHCVDFLVKFGVNIYALDIDKHSAKDLAAINGRDEILRYLDVAFTNFEATEKKK 132
            |.||.|::.||.|||.|||.||.||:|||.|..:..|.||...::|.:..||.|.|.......||
Human    67 TPLHFAASNGHAHCVSFLVNFGANIFALDNDLQTPLDAAASREQNECVALLDKAATAQNIMNPKK 131

  Fly   133 SKALKELAEKNCEKRVREYMKRQNQQQQRQDPEYSDLSAPSGSSKTGNMLSTLKQKIWSSQGNLN 197
            ...|||.|:||..::::|..:.|.:.|.:....||  ...||:             :.||:|..:
Human   132 VTRLKEQAQKNARRQIKECERLQEKHQNKMAHTYS--KEESGT-------------LSSSKGTFS 181

  Fly   198 K-TPRDTPPPTKFSDLVGNGSSSSGGSTIASRAGTVQKRPSQLQKQHSSTCPHSKISSDTDGGFK 261
            : :|.:...|..|..|                                     ||...||   ||
Human   182 RSSPSNASAPGTFGSL-------------------------------------SKGIKDT---FK 206

  Fly   262 VREVEPDGKRTITSLTGLQRDSEVLYVGTFSSNEDS---VGKRGKISDVFECMEADELDHSDNRS 323
            ::                           |..|:|:   |||.|: |.....||....:..|:.|
Human   207 IK---------------------------FKKNKDTAEQVGKEGR-SGQRNVMEVFREEEEDSFS 243

  Fly   324 G-YSSTLARSFSQPDILGDGQLTQELSEEVTLQRPVGLFDRPTMLGSIAFRRSVTAALSQLQLHT 387
            | :...|..|..:     ||.:..|           .:.:||. ||||.|||:        ::.:
Human   244 GDFKEKLQLSAEE-----DGSVHHE-----------SILNRPG-LGSIVFRRN--------RISS 283

  Fly   388 DTSSTSTMRNAGSNPPK---TRNGGGKGRLYLNLSDDTDSEGGGHDIYSDDDDD---DRD-AGGS 445
            ....:.:.|..|...|.   .|.|..:..  ...:|:...|.|..|....|||:   :.| ...:
Human   284 PEDISDSKREFGFKLPSELLQRQGASEAD--EGAADEEGEENGLKDDLPWDDDEVEWEEDVVDAT 346

  Fly   446 ALQRFLAVWALEEYLPVFQKQEIDLETLMLLTESDLKSLGLPLGPFRKLTFAIQERRNALANPGP 510
            .|:.||....|||:||:|::::||||.|:|.::.||:|:.:.|||.:|:..||..|:..|..||.
Human   347 PLEVFLLSQHLEEFLPIFKREQIDLEALLLCSDEDLQSIQMQLGPRKKVLNAINRRKQVLQQPGQ 411

  Fly   511 LVDSRL 516
            |||:.|
Human   412 LVDTSL 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SansNP_610829.1 ANK 6..118 CDD:238125 56/112 (50%)
Ank_2 6..96 CDD:289560 50/90 (56%)
ANK repeat 35..63 CDD:293786 16/28 (57%)
ANK repeat 65..96 CDD:293786 20/31 (65%)
Ank_2 70..149 CDD:289560 35/79 (44%)
SAM_USH1G_HARP 443..508 CDD:188916 26/65 (40%)
SAM 447..503 CDD:197735 25/56 (45%)
ANKS4BNP_665872.2 Mediates localization to microvilli. {ECO:0000269|PubMed:26812018} 1..252 104/333 (31%)
ANK 3..117 CDD:238125 57/114 (50%)
ANK repeat 3..29 CDD:293786 11/26 (42%)
Ank_2 6..95 CDD:289560 50/89 (56%)
ANK repeat 31..62 CDD:293786 18/31 (58%)
ANK repeat 64..95 CDD:293786 20/31 (65%)
ANK repeat 97..125 CDD:293786 9/28 (32%)
Mediates interaction with MYO7B. {ECO:0000269|PubMed:26812018} 253..346 26/120 (22%)
SAM_HARP 345..410 CDD:188986 27/65 (42%)
SAM 351..404 CDD:197735 24/53 (45%)
PDZ-binding, mediates interaction with USH1C. {ECO:0000269|PubMed:26812018} 415..417 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5747373
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I3356
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1344159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T609165
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24161
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5090
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.