DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sans and Ush1g

Sequence 1:NP_610829.1 Gene:Sans FlyBaseID:FBgn0033785 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_789817.1 Gene:Ush1g MGIID:2450757 Length:461 Species:Mus musculus

Alignment Length:549 Identity:181/550 (33%)
Similarity:271/550 (49%) Gaps:124/550 (23%)


  Fly     3 SDRFHKAAKDGLLDVLAAATRKDTNAKDSDSMTPVMWAAFEGRLDALRLLCGRGGDPDKCDQFGN 67
            :|::|:||:||.|::|..||||:.||.|.|.|||.:|||:.|.|::|||:..|||||||||.:||
Mouse     2 NDQYHRAARDGYLELLKEATRKELNAPDEDGMTPTLWAAYHGNLESLRLIVSRGGDPDKCDIWGN 66

  Fly    68 TALHLASAKGHLHCVDFLVKFGVNIYALDIDKHSAKDLAAINGRDEILRYLDVAFTNFEATEKKK 132
            |.||||::.|||||:.|||.||.||:.||.|.|:..|:||:.|..|.:||||.......:...|.
Mouse    67 TPLHLAASNGHLHCLSFLVSFGANIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKL 131

  Fly   133 SKALKELAEKNCEKRVREYMKRQNQQQQRQDPEY-------SDLSAPSGSSKTGNMLS------T 184
            ...||:.|.:..|:|:||..|.|.:..:|.:..|       ||  ..|.||.|.:.||      |
Mouse   132 VGKLKDKAFREAERRIRECAKMQRKHHERMERRYRRELAERSD--TLSFSSLTSSTLSRRLQHMT 194

  Fly   185 LKQKIWSSQGNLNKTPRDTPPPTKFSDLVGNGSSSSGGSTIASRAGTVQKRPSQLQKQHSSTCPH 249
            |..::..||..|:.|                          |.....:||: .:.:||..     
Mouse   195 LGSQLPYSQATLHGT--------------------------AKGKAKIQKK-LERRKQGG----- 227

  Fly   250 SKISSDTDGGFKVREVEPDGKRTITSLTGLQRDSEVLYV--GTFSSNEDSVGKRGKISDVFECME 312
                   :|.|||.|   ||::::.||:|||..|:|::|  ||:::.::  ..|..:.|:|    
Mouse   228 -------EGTFKVSE---DGRKSVRSLSGLQLGSDVMFVRQGTYANPKE--WGRAPLRDMF---- 276

  Fly   313 ADELDHSDNRSGYSSTLARSFSQPDILGDGQLTQELSEEVTLQRPVGLFDRPTMLGSIAFRRSVT 377
                 .||..|...:|||...:..::..|....             .||.||. ||::.|||:..
Mouse   277 -----LSDEDSVSRATLAAEPAHSEVSTDSGHD-------------SLFTRPG-LGTMVFRRNYV 322

  Fly   378 AALSQLQLHTDTSSTSTMRNAGSNPPKTRNGGG-------KGRLYLNLSDDTDSEGGGHDI---- 431
                          :|.:...|      |..||       :|||:.:.|.|.||.|..:.:    
Mouse   323 --------------SSGLHGLG------REDGGLDGAGTPRGRLHSSPSLDDDSLGSANSLQDRS 367

  Fly   432 ------YSDDD---DDDRDAGGSALQRFLAVWALEEYLPVFQKQEIDLETLMLLTESDLKSLGLP 487
                  :.:.|   |:|.:...|.|:.|||...:|::..:.:.::||||.|||.::.||:|:.:|
Mouse   368 CGEELPWDELDLGLDEDLEPETSPLETFLASLHMEDFASLLRHEKIDLEALMLCSDLDLRSISVP 432

  Fly   488 LGPFRKLTFAIQERRNALANPGPLVDSRL 516
            |||.:|:..|::.||.||..|..|.|:.|
Mouse   433 LGPRKKILGAVRRRRQALERPLALEDTEL 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SansNP_610829.1 ANK 6..118 CDD:238125 65/112 (58%)
Ank_2 6..96 CDD:289560 55/90 (61%)
ANK repeat 35..63 CDD:293786 18/28 (64%)
ANK repeat 65..96 CDD:293786 20/31 (65%)
Ank_2 70..149 CDD:289560 35/79 (44%)
SAM_USH1G_HARP 443..508 CDD:188916 26/65 (40%)
SAM 447..503 CDD:197735 23/56 (41%)
Ush1gNP_789817.1 ANK 6..117 CDD:238125 65/111 (59%)
Ank_2 6..91 CDD:289560 53/85 (62%)
ANK repeat 31..62 CDD:293786 20/31 (65%)
ANK 1 31..60 18/29 (62%)
ANK repeat 64..95 CDD:293786 20/31 (65%)
ANK 2 64..93 19/29 (66%)
Ank_2 69..>117 CDD:289560 27/48 (56%)
ANK 3 97..126 11/29 (38%)
SAM_USH1G 388..453 CDD:188985 26/65 (40%)
SAM 395..448 CDD:197735 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5747541
eggNOG 1 0.900 E33208_3BEMZ
Hieranoid 1 1.000
Homologene 1 1.000 H56113
Inparanoid 1 1.050 238 1.000 Inparanoid score I3335
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005514
OrthoInspector 1 1.000 T615984
orthoMCL 1 0.900 OOG5_135035
Panther 1 1.100 O PTHR24161
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5090
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.