DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sans and ush1g

Sequence 1:NP_610829.1 Gene:Sans FlyBaseID:FBgn0033785 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_004918531.1 Gene:ush1g XenbaseID:XB-GENE-1013607 Length:465 Species:Xenopus tropicalis

Alignment Length:529 Identity:177/530 (33%)
Similarity:265/530 (50%) Gaps:84/530 (16%)


  Fly     5 RFHKAAKDGLLDVLAAATRKDTNAKDSDSMTPVMWAAFEGRLDALRLLCGRGGDPDKCDQFGNTA 69
            |:|:||:||.||:|..|||:|.|:.|.|.|||.:|||:.|.|.|||::..|||||||||.:|||.
 Frog     4 RYHRAARDGFLDLLKEATRRDLNSPDEDGMTPTLWAAYHGHLGALRVIVSRGGDPDKCDIWGNTP 68

  Fly    70 LHLASAKGHLHCVDFLVKFGVNIYALDIDKHSAKDLAAINGRDEILRYLDVAFTNFEATEKKKSK 134
            ||:|:|.|||:|:.|||.||.||:.||.|.|:..|:||..|..|.:||||...........|...
 Frog    69 LHVAAANGHLNCLSFLVSFGANIWCLDNDYHTPLDMAASKGHMECVRYLDSIAAKQTGLNPKLVS 133

  Fly   135 ALKELAEKNCEKRVREYMKRQNQQQQRQDPEY-SDLSAPSGSSKTGNMLSTLKQKIWSSQGNLNK 198
            .|||.|.:..|||:|:..|.|.:..:|.:..| .|:|..|.:....:..|::.|:.         
 Frog   134 KLKERAFREAEKRIRDCAKLQRKHHERMERRYRRDMSDRSDTMSFSSYSSSVSQRY--------- 189

  Fly   199 TPRDTPPPTKFSDL-VGNGSSSSGGSTIASRAGTVQKRPSQLQKQHSSTCPHSKISSDTDGGFKV 262
                 |..|.|..: ..:.:.::.|.|      .:||:   |:|:           ..|||.||:
 Frog   190 -----PSATMFPTMPYSHAAGTTKGKT------KIQKK---LEKR-----------KQTDGMFKI 229

  Fly   263 REVEPDGKRTITSLTGLQRDSEVLYV--GTFSSNEDSVGKRGK--ISDVFECMEADELDHSDNRS 323
            .|   ||::::.||:|||..::|::|  ||::|..:    ||:  :.|:|       |...|   
 Frog   230 YE---DGRKSVRSLSGLQLGNDVMFVKQGTYASPRE----RGRQHLRDMF-------LPEED--- 277

  Fly   324 GYSSTLARSFSQPDILGDGQLTQELSEEVTLQRPVGLFDRPTMLGSIAFRRSVTAALSQLQLHTD 388
                :|:|:.|.|.:.|......|:|   |......||.||. ||::.|||:        .|.:.
 Frog   278 ----SLSRAISDPGLHGGDSAHSEVS---TDSGHDSLFTRPG-LGTMVFRRN--------YLSSG 326

  Fly   389 TSSTSTMRNAGSNPPKTRNGGGKGRLYLNLS-DDTDSEGGGHDIYSDDD----------DDDRDA 442
            ..........|..|........:.||..:.| ||:....|...:.::.:          |||.:.
 Frog   327 LFGMGRDEGNGLQPGLGEEVKLRSRLKRSPSLDDSIGSAGSLAVRNEQELPWEEEDLRLDDDEEP 391

  Fly   443 GGSALQRFLAVWALEEYLPVFQKQEIDLETLMLLTESDLKSLGLPLGPFRKLTFAIQERRNALAN 507
            ..|.|:.|||...:.:.:.|.|.::|||..|.|.::.||||:|:||||.:|:...||.||.|:..
 Frog   392 DTSPLESFLASLQMGDLVTVLQDEKIDLAALTLCSDHDLKSIGIPLGPRKKILDGIQRRRQAIDR 456

  Fly   508 PGPLVDSRL 516
            |..:.|:.|
 Frog   457 PSTMGDTEL 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SansNP_610829.1 ANK 6..118 CDD:238125 64/112 (57%)
Ank_2 6..96 CDD:289560 54/90 (60%)
ANK repeat 35..63 CDD:293786 18/28 (64%)
ANK repeat 65..96 CDD:293786 19/31 (61%)
Ank_2 70..149 CDD:289560 36/79 (46%)
SAM_USH1G_HARP 443..508 CDD:188916 27/65 (42%)
SAM 447..503 CDD:197735 25/56 (45%)
ush1gXP_004918531.1 ANK 6..117 CDD:238125 64/111 (58%)
Ank_2 6..91 CDD:289560 52/85 (61%)
ANK repeat 31..62 CDD:293786 20/31 (65%)
ANK repeat 64..95 CDD:293786 19/31 (61%)
Ank_2 69..>129 CDD:289560 28/60 (47%)
SAM 389..452 CDD:197735 26/63 (41%)
SAM_USH1G 392..457 CDD:188985 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5747697
eggNOG 1 0.900 E33208_3BEMZ
Hieranoid 1 1.000
Homologene 1 1.000 H56113
Inparanoid 1 1.050 242 1.000 Inparanoid score I3100
OMA 1 1.010
OrthoDB 1 1.010 D1344159at2759
OrthoFinder 1 1.000 FOG0005514
OrthoInspector 1 1.000 T601045
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5090
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.