DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sans and anks4b

Sequence 1:NP_610829.1 Gene:Sans FlyBaseID:FBgn0033785 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001121501.1 Gene:anks4b XenbaseID:XB-GENE-976167 Length:406 Species:Xenopus tropicalis

Alignment Length:526 Identity:165/527 (31%)
Similarity:242/527 (46%) Gaps:133/527 (25%)


  Fly     3 SDRFHKAAKDGLLDVLAAATRKDTNAKDSDSMTPVMWAAFEGRLDALRLLCGRGGDPDKCDQFGN 67
            |.|:|:||.||..::|..||:||.|..|.|.|||.:.||:.|.||.|.:||.|||||||.|.:||
 Frog     2 STRYHQAAIDGYQEILKEATKKDVNTTDGDGMTPTILAAYHGHLDVLEILCHRGGDPDKSDIWGN 66

  Fly    68 TALHLASAKGHLHCVDFLVKFGVNIYALDIDKHSAKDLAAINGRDEILRYLDVAFTNFEATEKKK 132
            |.||.|:.|||..||.|||.||.||:|||....:..|:|||..|.|.::.||.|.....:...||
 Frog    67 TPLHHAAEKGHASCVSFLVNFGANIFALDNKYRTPLDVAAIKDRIECVKILDGAANKQASLNPKK 131

  Fly   133 SKALKELAEKNCEKRVREYMKRQNQQQQRQDPEYSDLSAPSGSSKTGNMLSTLKQKIWSSQGNLN 197
            .:.|||.|.|:.:::|:|..|.|::.|.:....|:       .||.|.        :.||:|.|:
 Frog   132 VERLKEQAVKDADRKVKECEKIQDRHQNQMAKNYN-------KSKGGT--------VNSSKGTLS 181

  Fly   198 KTPRDTPPPTKFSDLVGNGSSSSGGSTIASRAGTVQKRPSQLQKQHSSTCPHSKISSDTDGGFKV 262
                                     .|:.:|..|    ||.:          |.||......|::
 Frog   182 -------------------------GTVGARFST----PSTI----------SSISKGLKDTFQL 207

  Fly   263 REVEPDGKRTITSLTGLQRDSEVLYVGTFSSNEDSVG-KRGKISDVFECMEADELDHSDNRSGYS 326
            : ::..||.||...|    .|.|::     :|::||. .|.|..|||                  
 Frog   208 K-LKKKGKNTIDRET----VSNVIF-----ANDESVNVSRPKAKDVF------------------ 244

  Fly   327 STLARSFSQPDILGDGQLTQELSEEVTLQRPVGLFDRPTMLGSIAFRRSVTAALSQLQLHTDTSS 391
                               .|..||...:....:|:||. ||::.|||::.:.:.     ||...
 Frog   245 -------------------NENEEENEGKEEESIFNRPG-LGNMMFRRNLASGIG-----TDFDD 284

  Fly   392 TSTMR-NAGSNPP------KTRNGGGKGRLYLNLSDDTDSEGGGHDIYSDD----DDDDRDAGGS 445
            .||:| :.|...|      :..||           :::|.|...:..:.:|    ||:|..   |
 Frog   285 LSTVRSDTGFQIPSELFTEEAENG-----------EESDDEQESNVAWDEDEVELDDEDET---S 335

  Fly   446 ALQRFLAVWALEEYLPVFQKQEIDLETLMLLTESDLKSLGLPLGPFRKLTFAIQERRNALANPGP 510
            |||.||....|.|......:::|||:.|||.:..||:|:.:||||.:|:..||::|:|.:..||.
 Frog   336 ALQVFLVSHGLIELFATLIREKIDLDALMLCSNEDLQSINIPLGPRKKVLNAIEKRKNIIDKPGK 400

  Fly   511 LVDSRL 516
            .||::|
 Frog   401 TVDTKL 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SansNP_610829.1 ANK 6..118 CDD:238125 59/112 (53%)
Ank_2 6..96 CDD:289560 52/90 (58%)
ANK repeat 35..63 CDD:293786 17/28 (61%)
ANK repeat 65..96 CDD:293786 20/31 (65%)
Ank_2 70..149 CDD:289560 35/79 (44%)
SAM_USH1G_HARP 443..508 CDD:188916 26/65 (40%)
SAM 447..503 CDD:197735 23/56 (41%)
anks4bNP_001121501.1 ANK 3..117 CDD:238125 60/114 (53%)
ANK repeat 3..29 CDD:293786 12/26 (46%)
Ank_2 6..95 CDD:289560 52/89 (58%)
ANK repeat 31..62 CDD:293786 19/31 (61%)
ANK repeat 64..95 CDD:293786 20/31 (65%)
SAM_USH1G_HARP 334..398 CDD:188916 26/67 (39%)
SAM 340..393 CDD:197735 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1344159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.