DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and APD2

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_195765.3 Gene:APD2 AraportID:AT5G01450 Length:444 Species:Arabidopsis thaliana

Alignment Length:494 Identity:103/495 (21%)
Similarity:165/495 (33%) Gaps:149/495 (30%)


  Fly   297 SKPGSSSSKADASSQSS---FEELGAIGGISDESK------------------ANTDTNSSHLDQ 340
            |.|.||||......::.   ||..|...|.....:                  .|...||:..|.
plant     6 SLPSSSSSPPVTREETGFHRFEHHGNDSGFDHRDRPPWNRSEYDYRHGSVVASENVRNNSTSEDP 70

  Fly   341 WQVLEV--------------------------NRIEAVEETPTTSAADEILEVTLRSRPAVEGDD 379
            |..:.|                          |....::  ||:.....::         ||   
plant    71 WSCVVVVATFCIFVSMTLILGLYGTTNVWLGPNSSFLIK--PTSVFVQNVI---------VE--- 121

  Fly   380 SEMGESTQAL---NVNQRP-----ANPSPAFYPAVPQRTKKVTRRRSDGYLNR--RYHSSDDESP 434
             |:|.....|   .:||.|     ...|...|.|||..:.|...:    |||:  |...|.:...
plant   122 -ELGNKGSGLILYGLNQAPQLDVLTKWSEVHYLAVPNDSYKYWIQ----YLNKGSRVKVSYNVES 181

  Fly   435 VAPGGPGLSL----GLSTLSEHPEHGLHPHSHRQSCQRCGKNKTNIRRHVEKMRRHLENSQMSEE 495
            |   |..|.|    |:..|||..:....|             .|.:..|:      :.:|...|:
plant   182 V---GSSLYLVIAQGVDGLSEWVQDPTRP-------------DTTLSWHI------ISDSGYIEQ 224

  Fly   496 DIKRELQEFL----TYLEQRTKSV---------DASDADSHAVSPLSVDAISVAAGGRSPDMPIT 547
            ||.:....::    .||.:...::         |.::|..:...|.....:||...|.:..:..:
plant   225 DITKSSSYYVAVGNVYLNEVKATIDIQVEGVLYDTTNAYYNCSFPNDKCTLSVPLFGTNAAVLTS 289

  Fly   548 PTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEP-------TAGIDSRFVNLED--FEDLKDL-EGL 602
            |..:.:.:::|            :.|...:||       ..|:.:..:.:..  |...:.: |..
plant   290 PGPKLNNSKNE------------FCAKLSYEPRWIAYIVCMGVVTALLLIVSSLFNKRQPVTEDE 342

  Fly   603 TVKQLKEV--LMLHRVDYKG--CCEKQELLDRVSRLWKTMRECPAVEKLATDELCKICMDAPIEC 663
            ||.:..:|  |:..:.|...  |.....:|.....|.....|..:    :|..||.||.|||.:|
plant   343 TVDENDDVAPLIPGKDDDNSSWCSSYSSILTSTEELEGAHGEGHS----STRYLCAICYDAPRDC 403

  Fly   664 VFLECGHMATCTSCGKVLNE----CPICRQYIVRVVRFF 698
            .||.|||...|..||..:.|    ||:||:.|.:|.:.|
plant   404 FFLSCGHCVACFQCGTRIAETSGFCPVCRKKIRKVKKIF 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289
zf-C3HC4_3 650..694 CDD:290631 22/48 (46%)
APD2NP_195765.3 DUF4792 129..197 CDD:292659 20/75 (27%)
DUF4793 224..327 CDD:292660 16/115 (14%)
zf-C3HC4_3 392..433 CDD:290631 21/41 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125041
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
21.910

Return to query results.
Submit another query.