DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and APD3

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_181357.2 Gene:APD3 AraportID:AT2G38220 Length:404 Species:Arabidopsis thaliana

Alignment Length:382 Identity:89/383 (23%)
Similarity:146/383 (38%) Gaps:72/383 (19%)


  Fly   350 EAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGESTQALNVNQRPANPSPAFYPAVPQRTKKVT 414
            |.|...|.:|...:...:.::|....|.|.|:.|......|   ..:.||..|......|...|:
plant    64 ETVWLGPNSSILVKPSSIFVKSIKVKELDFSKPGLQLYGFN---GQSTPSGYFVNWTESRVLSVS 125

  Fly   415 RRRSDG---YLNRRYHSSDDESPVAPGGPGLSLGLSTLSEHPEHGLHPHSHRQSCQRCGKNKT-- 474
            :....|   ||||..|.:...: :.|.|..:.|.::..|:  ..|: |..:|.|.:......|  
plant   126 QNSYKGWPYYLNRGTHMNISYN-ILPKGSAVRLVITEGSQ--VIGM-PFFYRSSLKDIAFRDTAW 186

  Fly   475 --NIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKSVDAS-DADSHAV----SPLSVDA 532
              |:          ::.|.|.:.||.:....:||....:.|.::.. |.|..||    ...|.:.
plant   187 SWNL----------IQGSGMIQLDISKSKGYYLTVANLKRKDIEVELDIDVKAVLYDTKQTSYNC 241

  Fly   533 ISVAAGGRSPDM----PI-TPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEPTAGIDSRFVNLED 592
             |.:.|..|..|    |: ...:..||...:.:..||:..|.:     .::|      |.:....
plant   242 -SFSNGECSFKMNERYPVENYAVVTSPALGQGVSIDDEWYIEL-----SYQP------RLIAYGS 294

  Fly   593 FEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECPAVEKLATD------- 650
            |      .|:.:..:  ::.:|..:...||..:..|....    ::|.|...:|...|       
plant   295 F------TGVLLSFM--LVAIHFCNKLKCCGGEGFLSGDD----SVRTCLLADKGDNDCCNDVEA 347

  Fly   651 ---ELCKICMDAPIECVFLECGHMATCTSCG----KVLNECPICRQYIVRVVRFFRA 700
               .||.||.|||.:|.||.|||..:|..||    :....|||||:.::.|.|.:.|
plant   348 SNKSLCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKMIHVKRIYTA 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289
zf-C3HC4_3 650..694 CDD:290631 22/58 (38%)
APD3NP_181357.2 DUF4792 97..164 CDD:292659 17/71 (24%)
DUF4793 200..305 CDD:292660 24/125 (19%)
zf-C3HC4_3 349..398 CDD:290631 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1361306at2759
OrthoInspector 1 1.000 T125041
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
32.920

Return to query results.
Submit another query.