DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and APD1

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_973633.2 Gene:APD1 AraportID:AT2G38185 Length:447 Species:Arabidopsis thaliana

Alignment Length:275 Identity:53/276 (19%)
Similarity:91/276 (33%) Gaps:100/276 (36%)


  Fly   487 LENSQMSEEDIKRELQEFLTYLEQRTKSVDASDADSHAVSPLSVDAI------------------ 533
            :|.|.|.:.:|::....:|.....::|.|:.:..|...:: :.|.|:                  
plant   208 IEGSGMIQLEIRKSSSYYLAVANLKSKDVEVTTTDQVELN-IDVKAVLYDTKQSFYNCNFSNGEC 271

  Fly   534 ---SVAAGGRSPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEPTAG---------IDSR 586
               :::..|.|       .:..||...:.:..:|:..|.....|.:.....|         :..:
plant   272 TFNAMSLVGNS-------VVVTSPAASQGVSIEDEWYIRFSYQPREIAYVIGTGVVICFMLVAIQ 329

  Fly   587 FVN---------------------LEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDR 630
            |.|                     |.|    ||.:|.::               |.|:.....| 
plant   330 FCNRFQCSGGEGHLTEDDSARTRLLAD----KDDDGSSM---------------GSCDDSYAND- 374

  Fly   631 VSRLWKTMRECPAVEKLATD--------ELCKICMDAPIECVFLECGHMATCTSCGKVLNE---- 683
                     :....|.:..|        .||.||.|.|.:|.||.|||..:|..||..:.|    
plant   375 ---------DADLEEFMGNDGEASNRSRRLCAICFDVPRDCFFLPCGHSVSCYECGTTMQEADGS 430

  Fly   684 CPICRQYIVRVVRFF 698
            |||||:.:.:|.|.:
plant   431 CPICRRKMKKVKRIY 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289
zf-C3HC4_3 650..694 CDD:290631 22/56 (39%)
APD1NP_973633.2 DUF4792 120..187 CDD:292659
DUF4793 217..326 CDD:292660 15/117 (13%)
zf-C3HC4_3 392..441 CDD:290631 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125041
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
21.910

Return to query results.
Submit another query.